DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1R15 and PPP1R15B

DIOPT Version :9

Sequence 1:NP_611863.1 Gene:PPP1R15 / 37820 FlyBaseID:FBgn0034948 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_116222.4 Gene:PPP1R15B / 84919 HGNCID:14951 Length:713 Species:Homo sapiens


Alignment Length:298 Identity:60/298 - (20%)
Similarity:92/298 - (30%) Gaps:128/298 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PEDLRI--PTLQPDPLNPLATMMSFKLMAMDVVTQMQTALHKCVNAQSPPGAKMAGIELDALRRC 129
            ||.|.:  .....||.||           .:....:|||                       .|.
Human   472 PEGLHLWNSFCSVDPYNP-----------QNFTATIQTA-----------------------ARI 502

  Fly   130 VPSSCYFFIDLHPHHGFKDTAEDCPTSQASSDRNNNAGCSQGSAAKSSWQRQRSISECSEDSFIC 194
            ||.        .|....||.:       ..||..|::  ..||..::.   :.|..|        
Human   503 VPE--------EPSDSEKDLS-------GKSDLENSS--QSGSLPETP---EHSSGE-------- 539

  Fly   195 FEDDAEQADEDVEEDE------DDDDDDSSVQFTA----CGEDENTEELKACQCSDDSSTPVKKV 249
             |||.|.:.::.|..:      :.||..:.:.|.|    .||:|     |.|:   ||.||.:.:
Human   540 -EDDWESSADEAESLKLWNSFCNSDDPYNPLNFKAPFQTSGENE-----KGCR---DSKTPSESI 595

  Fly   250 RFNMKPEVHVMLAWDYAYRAARKSE---------------------------------------- 274
              ....|.|.:|:.......:::||                                        
Human   596 --VAISECHTLLSCKVQLLGSQESECPDSVQRDVLSGGRHTHVKRKKVTFLEEVTEYYISGDEDR 658

  Fly   275 ---WQVMARDRDRFQQRIRRISPILNAVLTPVHRDRVY 309
               |:..|||..|||:||:.....:...||..||:|::
Human   659 KGPWEEFARDGCRFQKRIQETEDAIGYCLTFEHRERMF 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1R15NP_611863.1 PP1c_bdg <243..309 CDD:287462 21/108 (19%)
PPP1R15BNP_116222.4 CReP_N 1..410 CDD:287449
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..398
PP1c_bdg 413..699 CDD:287462 60/298 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..472 60/298 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..548 16/74 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16489
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5794
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.