Sequence 1: | NP_611863.1 | Gene: | PPP1R15 / 37820 | FlyBaseID: | FBgn0034948 | Length: | 317 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038684.3 | Gene: | ppp1r15b / 571470 | ZFINID: | ZDB-GENE-030829-40 | Length: | 488 | Species: | Danio rerio |
Alignment Length: | 317 | Identity: | 66/317 - (20%) |
---|---|---|---|
Similarity: | 101/317 - (31%) | Gaps: | 139/317 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 RRC-VPSSCYFFIDLHPHHGFKDTAEDCPTSQASSDRNNNAGCSQGSAAKSSWQRQRSISECSED 190
Fly 191 SF-------ICFEDDAEQADEDVEEDEDDDDDDSSVQFTAC------------------------ 224
Fly 225 -------------GEDENTEEL-KACQCSDD--------------SSTPV--------------- 246
Fly 247 --------------------------------------------------------KKVRFNMKP 255
Fly 256 EVHVMLAWDYAYRAARKSEWQVMARDRDRFQQRIRRISPILNAVLTPVHRDRVYQAR 312 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PPP1R15 | NP_611863.1 | PP1c_bdg | <243..309 | CDD:287462 | 28/136 (21%) |
ppp1r15b | NP_001038684.3 | PP1c_bdg | 200..482 | CDD:287462 | 56/284 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170583587 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | oto39919 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR16489 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5794 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 6.020 |