DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1R15 and ppp1r15b

DIOPT Version :9

Sequence 1:NP_611863.1 Gene:PPP1R15 / 37820 FlyBaseID:FBgn0034948 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001038684.3 Gene:ppp1r15b / 571470 ZFINID:ZDB-GENE-030829-40 Length:488 Species:Danio rerio


Alignment Length:317 Identity:66/317 - (20%)
Similarity:101/317 - (31%) Gaps:139/317 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RRC-VPSSCYFFIDLHPHHGFKDTAEDCPTSQASSDRNNNAGCSQGSAAKSSWQRQRSISECSED 190
            |:| ..|:|.|...:   .||  |.|.....:..||.::   |:.......|.::.:|||..|:.
Zfish   174 RKCGSESTCTFSAHV---AGF--TKEFVKHQKPISDPDS---CALSKENVQSSRQVQSISHFSDS 230

  Fly   191 SF-------ICFEDDAEQADEDVEEDEDDDDDDSSVQFTAC------------------------ 224
            .|       .|||.:.|::|:..:......|....:.||||                        
Zfish   231 EFSWGSTDSSCFEGEREESDKLWDLLTKSTDPYHPLHFTACLSTVVTEKPKPEVVSKAESPIASQ 295

  Fly   225 -------------GEDENTEEL-KACQCSDD--------------SSTPV--------------- 246
                         .|||..|.| ::...:||              |.|||               
Zfish   296 STVSTSSDSSKPGSEDEEEEALWRSLSQNDDPYHPLNFRAPLQSSSVTPVPSKHDSPSNNMQNTP 360

  Fly   247 --------------------------------------------------------KKVRFNMKP 255
                                                                    |||:|:...
Zfish   361 IRPLKSSRRSKPALLPNKVARHCCRKLSVETLSVVPWKRHVGVTSVQGNQKRSPRLKKVKFSPVV 425

  Fly   256 EVHVMLAWDYAYRAARKSEWQVMARDRDRFQQRIRRISPILNAVLTPVHRDRVYQAR 312
            :||.|.||.:|.:|:||..|:.:|||||||::||......:....:..||::|:..|
Zfish   426 QVHKMRAWSFALQASRKGPWEELARDRDRFRKRIIDTEKAIGYCFSLSHREKVWAYR 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1R15NP_611863.1 PP1c_bdg <243..309 CDD:287462 28/136 (21%)
ppp1r15bNP_001038684.3 PP1c_bdg 200..482 CDD:287462 56/284 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto39919
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16489
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5794
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.