DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1R15 and Ppp1r15b

DIOPT Version :9

Sequence 1:NP_611863.1 Gene:PPP1R15 / 37820 FlyBaseID:FBgn0034948 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001100645.1 Gene:Ppp1r15b / 304799 RGDID:1307944 Length:707 Species:Rattus norvegicus


Alignment Length:426 Identity:76/426 - (17%)
Similarity:125/426 - (29%) Gaps:173/426 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RPLSAG-SRTLWK----------PNKVHQEAPEVKPLEVPEDLRIPT----------------LQ 76
            :||.|. |.|.|:          |...|.....::.|:..:...:||                |:
  Rat   263 QPLCAEMSATAWRRCPPLSTEGLPEIHHLRMKRLEFLQANKGQELPTPDQDNGYHSLEEEHCLLR 327

  Fly    77 PDP---------------LNPLATMMSFKLMAMDVVTQMQTALHKCVNAQSPPGAKMAGIELDAL 126
            .||               .:|..|....:|:..:|:             |||.|:.:: .||...
  Rat   328 MDPQHCTDKAAQAVSPAGASPQPTEKKVELVVEEVL-------------QSPQGSSLS-CELSVQ 378

  Fly   127 RRCV--------------PSSCYFFID--LHPHHGFKDTAEDCPTSQASSDRNNNAGCSQGSAAK 175
            :.|.              |:.....||  |.......||:.|..:.....:..::...|.||.::
  Rat   379 KECEDYSDIGGNLPVSTRPACTNKLIDYILGGASSDLDTSSDSESEDWDEEPEDDGFDSDGSLSE 443

  Fly   176 SS----------WQRQRSISECSEDSFIC-FEDDAEQADEDVEEDE------------------- 210
            |.          |....|:...:..:|.. .:..|..|..|..:.|                   
  Rat   444 SDREQDSEGLHLWNSFYSVDPYNPQNFTATIQTAARIAPRDPSDSEKSWSGNSDVGSSQATLLPQ 508

  Fly   211 -------DDDDDDSSVQ--------------------------FTACGE--------DENT---- 230
                   ::||.:||..                          |...|:        .|.|    
  Rat   509 TPDQSSGEEDDWESSADEAENLRLWNSFCNSEDPYNLLNFKAPFQTSGKSWKGSQASSEATVVFS 573

  Fly   231 --EELKACQC-------------------SDDSSTPVKKVRFNMKPEV-HVMLAWDYAYRAARKS 273
              :.|.:|:.                   |.:..|.:|:.:.....|| ...::.|    ..||.
  Rat   574 GHQTLLSCEAQLLESQEDNCPGCGLGEALSGERYTHIKRKKVTFLEEVTEYYISGD----EDRKG 634

  Fly   274 EWQVMARDRDRFQQRIRRISPILNAVLTPVHRDRVY 309
            .|:..|||..|||:||:.....:...||..||:||:
  Rat   635 PWEEFARDGCRFQKRIQETEVAIGYCLTFEHRERVF 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1R15NP_611863.1 PP1c_bdg <243..309 CDD:287462 21/66 (32%)
Ppp1r15bNP_001100645.1 CReP_N 1..388 CDD:287449 25/138 (18%)
PP1c_bdg 391..673 CDD:287462 51/284 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16489
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.