DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1R15 and PPP1R15A

DIOPT Version :9

Sequence 1:NP_611863.1 Gene:PPP1R15 / 37820 FlyBaseID:FBgn0034948 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_055145.3 Gene:PPP1R15A / 23645 HGNCID:14375 Length:674 Species:Homo sapiens


Alignment Length:433 Identity:94/433 - (21%)
Similarity:138/433 - (31%) Gaps:172/433 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EQYRFGPSRPLSAGSR-TLWK--PNKVHQEAPEVKPLEVPEDLRIPTLQP-----DPLNPLATMM 87
            |.:|...| .||.||: :.|.  |.:...:|.|.|..|..:..|..::.|     ||       .
Human   202 EAHRTSTS-ALSPGSKPSTWVSCPGEEENQATEDKRTERSKGARKTSVSPRSSGSDP-------R 258

  Fly    88 SFKLMAMDVVTQMQTALHK-CVNAQSPPGAK---------------------------MAGIELD 124
            |::..:.:...:.:...|| ....::.||.:                           :...|.|
Human   259 SWEYRSGEASEEKEEKAHKETGKGEAAPGPQSSAPAQRPQLKSWWCQPSDEEEGEVKALGAAEKD 323

  Fly   125 ALRRCVPSSCYFFIDLHPHHGF---------------KDTAEDCPTSQASSDRNNNAGCSQGSAA 174
            ....|.|  |     :.|...|               :|..||..:...|.:....|..|..:.|
Human   324 GEAECPP--C-----IPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEASSSTPA 381

  Fly   175 K----SSWQRQ---RSISECSEDSFICFEDDAEQAD--------------------EDVEEDEDD 212
            .    .||..|   .:..|..|||.....:|..:|:                    ||.||:||:
Human   382 TGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDE 446

  Fly   213 D------DDDSSVQFTACGEDEN-----------------------TEELKACQ-------C--- 238
            |      :|||.   .|.||.|:                       |||.:|.:       |   
Human   447 DVDSEDKEDDSE---AALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFR 508

  Fly   239 -----------------------------------SDDSSTPVK--KVRFNMKPEVHVMLAWDYA 266
                                               ..|..||:|  ||||:.|..||.:..|...
Human   509 VAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAGP 573

  Fly   267 YRAARKSEWQVMARDRDRFQQRIRRISPILNAVLTPVHRDRVY 309
            .:|||:..|:.:||||.||.:||.:....|:..|||..|.|.:
Human   574 AQAARQGPWEQLARDRSRFARRITQAQEELSPCLTPAARARAW 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1R15NP_611863.1 PP1c_bdg <243..309 CDD:287462 29/67 (43%)
PPP1R15ANP_055145.3 Required for localization in the endoplasmic reticulum 1..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..504 63/319 (20%)
4 X 34 AA approximate repeats 337..510 36/175 (21%)
Interaction with SMAD7. /evidence=ECO:0000269|PubMed:14718519 337..510 36/175 (21%)
Interaction with KMT2A/MLL1 483..555 9/71 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 534..554 4/19 (21%)
Interaction with SMARCB1 536..583 15/46 (33%)
PP1c_bdg <549..608 CDD:313670 24/58 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 625..674
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149457
Domainoid 1 1.000 55 1.000 Domainoid score I11157
eggNOG 1 0.900 - - E1_2DZKW
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006935
OrthoInspector 1 1.000 - - oto89513
orthoMCL 1 0.900 - - OOG6_113613
Panther 1 1.100 - - LDO PTHR16489
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5794
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.