Sequence 1: | NP_611863.1 | Gene: | PPP1R15 / 37820 | FlyBaseID: | FBgn0034948 | Length: | 317 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032680.1 | Gene: | Ppp1r15a / 17872 | MGIID: | 1927072 | Length: | 657 | Species: | Mus musculus |
Alignment Length: | 244 | Identity: | 58/244 - (23%) |
---|---|---|---|
Similarity: | 79/244 - (32%) | Gaps: | 87/244 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 KDTAED-CPTSQASSDRNNNAGCSQGSAAKSSW--------QRQRSISECSEDSFICFEDDA--- 199
Fly 200 -----------------EQADEDVEEDEDDDD--------DDSS----VQFTACGEDENT----E 231
Fly 232 E----------------------------------LKACQCSDDSSTPVK--KVRFNMKPEVHVM 260
Fly 261 LAWDYAYRAARKSEWQVMARDRDRFQQRIRRISPILNAVLTPVHRDRVY 309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PPP1R15 | NP_611863.1 | PP1c_bdg | <243..309 | CDD:287462 | 27/67 (40%) |
Ppp1r15a | NP_032680.1 | Required for localization in the endoplasmic reticulum. /evidence=ECO:0000250|UniProtKB:O75807 | 1..60 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 65..89 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 101..123 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 156..278 | ||||
4.5 X approximate repeats | 283..451 | 14/84 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 291..496 | 26/129 (20%) | |||
Interaction with SMAD7. /evidence=ECO:0000250 | 323..503 | 28/136 (21%) | |||
Interaction with KMT2A/MLL1. /evidence=ECO:0000250 | 443..548 | 20/104 (19%) | |||
Interaction with SMARCB1. /evidence=ECO:0000250 | 529..576 | 15/46 (33%) | |||
PP1c_bdg | <545..612 | CDD:287462 | 26/65 (40%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 610..657 | 58/244 (24%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167839517 | |
Domainoid | 1 | 1.000 | 49 | 1.000 | Domainoid score | I11789 |
eggNOG | 1 | 0.900 | - | - | E1_2DZKW | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0006935 | |
OrthoInspector | 1 | 1.000 | - | - | oto93084 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_113613 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR16489 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5794 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.860 |