DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1R15 and Ppp1r15b

DIOPT Version :9

Sequence 1:NP_611863.1 Gene:PPP1R15 / 37820 FlyBaseID:FBgn0034948 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_598580.1 Gene:Ppp1r15b / 108954 MGIID:2444211 Length:697 Species:Mus musculus


Alignment Length:195 Identity:40/195 - (20%)
Similarity:65/195 - (33%) Gaps:64/195 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 SAAKSSWQRQRSISECSE-------DSFICFEDDAEQADEDVE---------EDEDD-------- 212
            |.:.:||.....:..|.|       |.....|||.|.:.::.|         ..||.        
Mouse   492 SDSGTSWSGSCGVGSCQEGPLPETPDHSSGEEDDWEPSADEAENLKLWNSFCHSEDPYNLLNFKA 556

  Fly   213 ------------DDDDSSVQFTACGEDENTEELKACQC----SDDSSTP---------------- 245
                        .|..:|.:.|......:|  |.:|:.    |.:.:.|                
Mouse   557 PFQPSGKNWKGRQDSKASSEATVAFSGHHT--LLSCKAQLLESQEDNCPGCGLGEALAGERYTHI 619

  Fly   246 -VKKVRFNMKPEVHVMLAWDYAYRAARKSEWQVMARDRDRFQQRIRRISPILNAVLTPVHRDRVY 309
             .|||.| ::......::.|    ..||..|:..|||..|||:||:.....:...|...||::::
Mouse   620 KRKKVTF-LEEVTEYYISGD----EDRKGPWEEFARDGCRFQKRIQETEVAIGYCLAFEHREKMF 679

  Fly   310  309
            Mouse   680  679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1R15NP_611863.1 PP1c_bdg <243..309 CDD:287462 20/82 (24%)
Ppp1r15bNP_598580.1 CReP_N 1..394 CDD:287449
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..354
PP1c_bdg 397..682 CDD:287462 40/195 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 417..456
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..531 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16489
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5794
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.