Sequence 1: | NP_611863.1 | Gene: | PPP1R15 / 37820 | FlyBaseID: | FBgn0034948 | Length: | 317 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598580.1 | Gene: | Ppp1r15b / 108954 | MGIID: | 2444211 | Length: | 697 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 40/195 - (20%) |
---|---|---|---|
Similarity: | 65/195 - (33%) | Gaps: | 64/195 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 SAAKSSWQRQRSISECSE-------DSFICFEDDAEQADEDVE---------EDEDD-------- 212
Fly 213 ------------DDDDSSVQFTACGEDENTEELKACQC----SDDSSTP---------------- 245
Fly 246 -VKKVRFNMKPEVHVMLAWDYAYRAARKSEWQVMARDRDRFQQRIRRISPILNAVLTPVHRDRVY 309
Fly 310 309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PPP1R15 | NP_611863.1 | PP1c_bdg | <243..309 | CDD:287462 | 20/82 (24%) |
Ppp1r15b | NP_598580.1 | CReP_N | 1..394 | CDD:287449 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 328..354 | ||||
PP1c_bdg | 397..682 | CDD:287462 | 40/195 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 417..456 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 486..531 | 10/38 (26%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167839516 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR16489 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5794 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.060 |