DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3065 and sp9

DIOPT Version :10

Sequence 1:NP_611861.1 Gene:CG3065 / 37818 FlyBaseID:FBgn0034946 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_998125.2 Gene:sp9 / 405896 ZFINID:ZDB-GENE-040426-2313 Length:447 Species:Danio rerio


Alignment Length:225 Identity:81/225 - (36%)
Similarity:108/225 - (48%) Gaps:47/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPT-PQMLTTSTPI---EPMKPPPAFPTMSGANIHEQASDMILRASTIFEDVKHDEANVENVPHH 68
            :|| ..:|:||..:   |..|  ...||.:.|:   ..:.||..||:                  
Zfish   233 SPTASHLLSTSQHLLTQEGFK--TVIPTYTDAS---ATNAMISGASS------------------ 274

  Fly    69 GVETEPEDDSHYGG-------NGNSKIRIMPSVKLMATTLASDPKRKFV--CPYDNCTKSYGKSS 124
            |:.|.......|.|       |.....|:.|:        .:..:||.:  |....|.|.|||:|
Zfish   275 GIGTSSRSSRRYSGRATCDCPNCQEAERLGPA--------GASLRRKGLHSCHIPGCGKVYGKTS 331

  Fly   125 HLRSHLTWHTGIKPFVCSEPKCGKGFTRSDELNRHLRTHTGEKPFECIQCTKKFSRSDHLTKHLA 189
            ||::||.||||.:||||:...|||.|||||||.||||||||||.|.|..|.|:|.|||||:||:.
Zfish   332 HLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHIK 396

  Fly   190 THDRQLKGSTPKRTVPSSSGGVRLKPPKKQ 219
            ||   ..|...|:...|.:....|:.|:.:
Zfish   397 TH---TAGGGGKKGSDSDTDTSNLETPRSE 423

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG3065NP_611861.1 COG5048 99..>400 CDD:227381 60/123 (49%)
C2H2 Zn finger 111..133 CDD:275368 11/21 (52%)
C2H2 Zn finger 141..163 CDD:275368 15/21 (71%)
C2H2 Zn finger 171..191 CDD:275368 11/19 (58%)
C2H2 Zn finger 348..368 CDD:275368
C2H2 Zn finger 376..396 CDD:275368
sp9NP_998125.2 SP9_N 27..317 CDD:411695 23/114 (20%)