Sequence 1: | NP_611861.1 | Gene: | CG3065 / 37818 | FlyBaseID: | FBgn0034946 | Length: | 400 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_476601.1 | Gene: | wor / 34906 | FlyBaseID: | FBgn0001983 | Length: | 548 | Species: | Drosophila melanogaster |
Alignment Length: | 240 | Identity: | 68/240 - (28%) |
---|---|---|---|
Similarity: | 99/240 - (41%) | Gaps: | 37/240 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 PTMSGANIH------EQASDMILRASTIFEDVKHDEANVEN------VPHHGVETEPEDDSHYGG 82
Fly 83 NGNSKIRIMPSVKLMATTLASDPKRKFVCPYDNCTKSYGKSSHLRSHLTWHTGIKPFVCSEPKCG 147
Fly 148 KGFTRSDELNRHLRTHTGEKPFECIQCTKKFSRSDHLTKHLATHDRQLKGSTPKRTVPSSSGGVR 212
Fly 213 LKPPKKQIHSESDSGFHFMAAMVGCGEPSMKHHHQ--QQQHNQHQ 255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3065 | NP_611861.1 | COG5048 | 99..>400 | CDD:227381 | 51/159 (32%) |
C2H2 Zn finger | 111..133 | CDD:275368 | 7/21 (33%) | ||
zf-C2H2 | 139..163 | CDD:278523 | 10/23 (43%) | ||
C2H2 Zn finger | 141..163 | CDD:275368 | 10/21 (48%) | ||
zf-H2C2_2 | 155..180 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 171..191 | CDD:275368 | 5/19 (26%) | ||
zf-C2H2 | 346..368 | CDD:278523 | |||
C2H2 Zn finger | 348..368 | CDD:275368 | |||
zf-H2C2_2 | 360..385 | CDD:290200 | |||
C2H2 Zn finger | 376..396 | CDD:275368 | |||
wor | NP_476601.1 | C2H2 Zn finger | 270..290 | CDD:275368 | |
C2H2 Zn finger | 317..334 | CDD:275368 | 6/25 (24%) | ||
zf-C2H2 | 345..367 | CDD:278523 | 3/21 (14%) | ||
C2H2 Zn finger | 347..367 | CDD:275368 | 3/19 (16%) | ||
PHA00732 | 379..>417 | CDD:177300 | 16/43 (37%) | ||
C2H2 Zn finger | 382..402 | CDD:275368 | 7/21 (33%) | ||
zf-C2H2_8 | 405..482 | CDD:292531 | 31/76 (41%) | ||
zf-C2H2 | 406..428 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 408..428 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 421..444 | CDD:290200 | 13/22 (59%) | ||
zf-C2H2 | 434..456 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 436..456 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 448..473 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 464..481 | CDD:275368 | 4/16 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S2499 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |