DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10904 and hng3

DIOPT Version :10

Sequence 1:NP_611860.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster


Alignment Length:149 Identity:26/149 - (17%)
Similarity:50/149 - (33%) Gaps:46/149 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 DMCYPDQDVEKQSQ---SSIESLESMIIENDAEICQP-------------------PKVSEPIPP 186
            |..:||.....::|   :::.....|    |.|:|:.                   .....|.|.
  Fly    18 DARHPDHANRPETQRLWNAVAEATGM----DVELCRTKWKNLRCSYRRSNRRSGILKHQQSPSPG 78

  Fly   187 MPPEPAPSSKFVDPNR-----------TVEAPAAPSPFHLPL---------SGRDQWDAFGELIA 231
            .....|.:..|:|..|           .:|:.......|:|:         |..|:.:|..:.:.
  Fly    79 HQWSYAEAMSFLDGQREECDNSNNGEEEMESALKIEAEHMPMLSTFKSEQVSAADEMEADNDALM 143

  Fly   232 SEFRNLNSEVSRKRLKRKI 250
            .||:|:::..:.:||...|
  Fly   144 REFQNVSTPQALRRLSENI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10904NP_611860.1 MADF 31..125 CDD:214738
hng3NP_612057.1 MADF 5..91 CDD:214738 12/76 (16%)
BESS 240..274 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.