DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10904 and CG3163

DIOPT Version :9

Sequence 1:NP_001286800.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611872.1 Gene:CG3163 / 37836 FlyBaseID:FBgn0034961 Length:368 Species:Drosophila melanogaster


Alignment Length:242 Identity:51/242 - (21%)
Similarity:86/242 - (35%) Gaps:72/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEI-TKHD--YG-----KKVHNLRNQF 85
            |...||.|:|:.|||...|..::|:..|.:|...:   :|: |||.  |.     :|::|||..|
  Fly     4 IDDFIEEYKSNPCLWKADSADFRNRSRRQEAYAKL---IEVATKHGEMYNVERTKQKINNLRCAF 65

  Fly    86 NAELKKLERRLEESGGDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQGAPGKKLVSKLDMCYPDQ 150
            ..:|:|...  .:..|::......:..:|::||||:                             
  Fly    66 RHQLRKYNE--VKKKGEKYEPYCPKRRYFESLMFLK----------------------------- 99

  Fly   151 DVEKQSQSSIESLESMIIENDAEICQPPKVSEPIPP----MPPEPAPSSKFVDPNRTVE------ 205
            |.|..:....:..:|:.::|..::..|....|....    .||:|...|..:.||.:..      
  Fly   100 DEEIPADKKFKREQSVCLDNSMQLGAPENGDEYSDAESLHKPPKPTADSIKMSPNNSANEFCANI 164

  Fly   206 -----APAAPSPFHLPLSGRDQWDAFGELIASEFRNLNSEVSRKRLK 247
                 |.||..|.               :......|.||..|...:|
  Fly   165 FEEAAAAAAADPV---------------ISIKTVNNANSHASGATIK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 29/101 (29%)
CG3163NP_611872.1 MADF_DNA_bdg 7..98 CDD:287510 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.