DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10904 and CG5953

DIOPT Version :9

Sequence 1:NP_001286800.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001260503.1 Gene:CG5953 / 34985 FlyBaseID:FBgn0032587 Length:701 Species:Drosophila melanogaster


Alignment Length:99 Identity:28/99 - (28%)
Similarity:45/99 - (45%) Gaps:4/99 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 WTREKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEITKHDYGKKVHNLRNQFNAE 88
            ||.:...:|||.||....|||.....||:|.||.:|...|......:|.:..:|::.|..|:..|
  Fly    78 WTNDDALELIEQYRCHTELWNRADPKYKDKLCRFRAWSEIAERFGCSKAEVERKMNVLLTQYRRE 142

  Fly    89 LKKLERRLEESGGDRDSEKACRWEHFKTLMFLRS 122
            ..|:..::.:......|    :|..||...|:.:
  Fly   143 KHKMFVKIYQGIQPNPS----KWYAFKRFDFMEA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 26/92 (28%)
CG5953NP_001260503.1 MADF_DNA_bdg 86..170 CDD:287510 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZ4Q
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.