DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10904 and CG15601

DIOPT Version :9

Sequence 1:NP_001286800.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:269 Identity:71/269 - (26%)
Similarity:107/269 - (39%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TREKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEI---TKHDYGKKVHNLRNQFN 86
            |:..|.:.:|.||...||:|...:.|||:..|.:|..:|..||:|   |..|...|:.::|..::
  Fly     7 TKIPITEFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLKIPQLTVSDIKLKIKSVRTVYS 71

  Fly    87 AELKKLERRLEESGGDRDSEKACRWEHFKTL-MFLRSVIE---PRPGYQQGAPGKKLVSKLD--- 144
            .|| ::..|.:|.|  |..|....|  |:.. .|||||..   .|.|....:..:....|.|   
  Fly    72 KEL-RIWMREKELG--RTYEPKLFW--FRLADSFLRSVSLSHCKRQGKNNSSSAQLTTIKSDETS 131

  Fly   145 --MCYPDQDVEKQSQSSIESLESMIIENDAEICQPPKVSEPIPPMPPEPAPSSKFVDPNRTVEAP 207
              :|....|: ..|:.::|       |.|||:...|   |..|  ..|..|::.....:.|:...
  Fly   132 KLLCTAAADI-TMSEDALE-------EEDAEVNGEP---EECP--LEESRPTASICKDDSTLCLA 183

  Fly   208 AAPSPFH-------------------------LPLSGRDQWDAFGELIASEFRNLNSEVSRKRLK 247
            ..|...|                         |..:|.|....||:.|||:.|.:....||...|
  Fly   184 DQPQQEHYSQGCSSSQQLPHTMAQRKSKYITSLDSAGEDDLIIFGQSIASQLRTIPDSYSRSVAK 248

  Fly   248 RKIMQVMLE 256
            .:|.||:.|
  Fly   249 LRIQQVLFE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10904NP_001286800.1 MADF 31..125 CDD:214738 33/97 (34%)
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.