DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alas and AT3G48790

DIOPT Version :9

Sequence 1:NP_477281.1 Gene:Alas / 37815 FlyBaseID:FBgn0020764 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_190448.1 Gene:AT3G48790 / 824040 AraportID:AT3G48790 Length:350 Species:Arabidopsis thaliana


Alignment Length:325 Identity:92/325 - (28%)
Similarity:166/325 - (51%) Gaps:22/325 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 ISGNSLHHERLESKLAELHQKEAALLFTSCFVANDSTLFTLAKLLPGCEIFSDAGNHASMIMGIR 243
            :||.:..|..||..:|:...|.||::|...::.|.:.:..|  :..|..|.||:.||.|:|.|.|
plant     5 LSGTTAVHGELEECVAKFVGKPAAVVFGMGYLTNSAIISVL--IGKGGLIISDSLNHTSIINGAR 67

  Fly   244 NSGVPKHIFRHNDV-DHLHQLLKQTDKSVPK-IVAFETVHSMTGAICPLEELLDVAHEHGAITFI 306
            .||....:|:||.: :|:.:...:|.:...| ||..|.::||.|.||.|.|::.|..|:.|..::
plant    68 GSGATIRVFQHNILKEHIIEGQPRTHRPWKKIIVVVEGIYSMEGEICDLPEIVSVCSEYKAYVYL 132

  Fly   307 DEVHAVGLYGDHGAGVGERDGV-LHKMDIISGTLGKAFGNIGGYIAGTHNLVDMIRSYAAGFIFT 370
            ||.|::|..|..|.||.|..|| ..::||:.||..|:.|:.||||||:.:||..::.:....::.
plant   133 DEAHSIGAIGKTGRGVCELLGVDTTEVDIMMGTFTKSLGSCGGYIAGSKDLVQYLKQHYPAHLYA 197

  Fly   371 TSLPPTVLCGALEAVNILASEEGRQLRHLH----QRNVSYLKSLLKREGFP---VEETPSHIIPI 428
            ||:........:.|:.::...:|.....|.    :.|.::.::.|::.||.   |.::|  |:||
plant   198 TSISTPAAQQVISAIKVIFGVDGSNRGELKLARIRENSNFFRAELQKMGFKVLGVYDSP--IMPI 260

  Fly   429 KIGDPLKSSQISNVLIEQFGHYLQSINYPTVARGQEKLRLAPTPFHTFEMMNALVTDLKKVWEMV 493
            .:.:|.|.:..|...:.: ...:..:::|.:.....:.|:..:..|..|       ||.|..:::
plant   261 MLYNPAKIAAFSRECLRE-NLAIVVVSFPPIPLLLARARICNSASHLRE-------DLIKALQVI 317

  Fly   494  493
            plant   318  317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlasNP_477281.1 AAT_I 93..495 CDD:302748 92/325 (28%)
BioF 95..490 CDD:223234 92/320 (29%)
AT3G48790NP_190448.1 PLN02483 <7..338 CDD:178101 91/323 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D930001at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.