DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alas and gcat

DIOPT Version :9

Sequence 1:NP_477281.1 Gene:Alas / 37815 FlyBaseID:FBgn0020764 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001166025.1 Gene:gcat / 402822 ZFINID:ZDB-GENE-060518-3 Length:431 Species:Danio rerio


Alignment Length:431 Identity:140/431 - (32%)
Similarity:228/431 - (52%) Gaps:36/431 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 STGANAHANAGGPATANATAPVSAPASADPGKASAKETFPYERFFNEQIMKKKRDHSYRVFKKVN 119
            ||.|.|...|..||...|   |.:...|:.....|..|:..||.    |..|:..|         
Zfish    21 STAAVAARRAFAPAAPQA---VQSVLEAELDSIRAAGTWKGERV----ITSKQGPH--------- 69

  Fly   120 RLAGDGLFPHALEYSERTEKPITVWCSNDYLGMSAHPGVKRAVQDALNRHGSGAGGTRNISGNSL 184
             :..||           :...|..:|:|:|||:|:||.|.:|..:||.::|:|....|.|.|...
Zfish    70 -ICVDG-----------SRGDILNFCANNYLGLSSHPEVVKAGVEALQKYGAGLSSVRFICGTQD 122

  Fly   185 HHERLESKLAELHQKEAALLFTSCFVANDSTLFTLAKLLPGCEIFSDAGNHASMIMGIRNSGVPK 249
            .|:.||.|||:.|::|..:|:.|||.|| :.||.:. |.|...:.||..||||:|.|||.....:
Zfish   123 IHKNLEEKLAQFHEREDCILYASCFDAN-AGLFEVL-LGPDDAVLSDELNHASIIDGIRLCRAKR 185

  Fly   250 HIFRHNDVDHLHQLLKQTDKSVPKIVAFETVHSMTGAICPLEELLDVAHEHGAITFIDEVHAVGL 314
            ..::|.|::.|.:.||::..|..::|..:.|.||.|.:.||:.:.|:|.::||:.||||.||.|.
Zfish   186 FRYKHMDLNDLEEKLKESQSSRLRLVVTDGVFSMDGDVAPLKGICDLAEQYGAMVFIDECHATGF 250

  Fly   315 YGDHGAGVGERDGVLHKMDIISGTLGKAFGN-IGGYIAGTHNLVDMIRSYAAGFIFTTSLPPTVL 378
            .|..|.|..|..||:.::.|::.|||||.|. .|||..|...|::::|..:..::|:.||||.|:
Zfish   251 MGARGRGTDELLGVMDRVQIVNSTLGKALGGAAGGYTVGPKALIELLRQRSRPYLFSNSLPPPVV 315

  Fly   379 CGALEAVN-ILASEEGRQLRHLHQRNVSYLKSLLKREGFPVEETPSHIIPIKIGDPLKSSQISNV 442
            ..|..||. :|||.|..|  .:..:.:.: ::.:.:.||.:..:...|.|:.:||...:|.:::.
Zfish   316 GCATRAVELLLASNEIAQ--SMAAKTMRF-RNNMTQAGFTISGSAHPICPVMLGDARLASLMADD 377

  Fly   443 LIEQFGHYLQSINYPTVARGQEKLRLAPTPFHTFEMMNALV 483
            :: :.|.|:...:||.|.:|:.::|:..:..||.|.::..|
Zfish   378 ML-KLGVYVIGFSYPVVPKGKARIRVQISAAHTDEDIDRTV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlasNP_477281.1 AAT_I 93..495 CDD:302748 128/393 (33%)
BioF 95..490 CDD:223234 128/391 (33%)
gcatNP_001166025.1 PRK06939 37..430 CDD:235893 133/415 (32%)
BioF 40..420 CDD:223234 131/409 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58214
OrthoDB 1 1.010 - - D930001at2759
OrthoFinder 1 1.000 - - FOG0000902
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100359
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R554
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.