DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alas and gcat

DIOPT Version :9

Sequence 1:NP_477281.1 Gene:Alas / 37815 FlyBaseID:FBgn0020764 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_989284.1 Gene:gcat / 394899 XenbaseID:XB-GENE-984769 Length:415 Species:Xenopus tropicalis


Alignment Length:372 Identity:123/372 - (33%)
Similarity:201/372 - (54%) Gaps:19/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KKVNRLAGDGLF-----------PHALEYSERTEKPITVWCSNDYLGMSAHPGVKRAVQDALNRH 169
            |::..:.|.|.:           ||.  ..|..:..|..:|:|:|||:|:||.|.||..:.|...
 Frog    29 KELEAIRGAGTWKSERIITSKQGPHI--KVEGKDTGILNFCANNYLGLSSHPQVIRAACETLEEF 91

  Fly   170 GSGAGGTRNISGNSLHHERLESKLAELHQKEAALLFTSCFVANDSTLFTLAKLLPGCEIFSDAGN 234
            |:|....|.|.|....|:.||.|:|..||:|.|:|:.|||.|| :.:|. |.|.|...:.||..|
 Frog    92 GAGLSSVRFICGTQNIHKSLEQKIARFHQREDAILYISCFDAN-AGIFE-ALLSPEDAVLSDELN 154

  Fly   235 HASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQTDKSVPKIVAFETVHSMTGAICPLEELLDVAHE 299
            |||:|.|||.....|:.::|.|:|.|...||:..|...:::|.:.|.||.|.|.||.|:..:|..
 Frog   155 HASIIDGIRLCKANKYRYKHMDLDDLEAKLKEAQKHRLRLIATDGVFSMDGDIAPLREICSLAKR 219

  Fly   300 HGAITFIDEVHAVGLYGDHGAGVGERDGVLHKMDIISGTLGKAFGN-IGGYIAGTHNLVDMIRSY 363
            :.|:.||||.||.|..|.:|.|..|..||:.::.|::.|||||.|. .|||..|...|:|::|..
 Frog   220 YNALVFIDECHATGFMGPNGRGTDELLGVMDQVTIVNSTLGKALGGAAGGYTTGPKPLIDLLRQR 284

  Fly   364 AAGFIFTTSLPPTVLCGALEAVNILASEEGRQLRHLHQRNVSYLKSLLKREGFPVEETPSHIIPI 428
            :..::|:.:|||.|:..|.:|:::|.  |..::...........::.:...||.:......|.|:
 Frog   285 SRPYLFSNTLPPAVVGSASKALDLLM--ESNEIAQSVAAKTKRFRTKMTEAGFTISGKDHPICPV 347

  Fly   429 KIGDPLKSSQISNVLIEQFGHYLQSINYPTVARGQEKLRLAPTPFHT 475
            .:||...:|.:::.|::: |.|:...::|.|.:|:.::|:..:..|:
 Frog   348 MLGDARLASLMADDLLQR-GIYVIGFSFPVVPKGKARIRVQISTAHS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlasNP_477281.1 AAT_I 93..495 CDD:302748 123/372 (33%)
BioF 95..490 CDD:223234 123/372 (33%)
gcatNP_989284.1 AAT_I 23..414 CDD:302748 123/372 (33%)
BioF 27..408 CDD:223234 123/372 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D930001at2759
OrthoFinder 1 1.000 - - FOG0000902
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.