DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alas and Sptlc1

DIOPT Version :9

Sequence 1:NP_477281.1 Gene:Alas / 37815 FlyBaseID:FBgn0020764 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001101876.1 Gene:Sptlc1 / 361213 RGDID:1307140 Length:473 Species:Rattus norvegicus


Alignment Length:332 Identity:98/332 - (29%)
Similarity:167/332 - (50%) Gaps:45/332 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 WCSNDYLGMSAHPGVKRAVQDALNRHGSGAGGTRNISGNSLHHERLESKLAELHQKEAALLFTSC 208
            :.|.::||:.|:|.||.|...:|.::|.|..|.|...|....|..||.:||:..:.|.|::::..
  Rat   103 FASFNFLGLLANPRVKAAAFASLKKYGVGTCGPRGFYGTFDVHLDLEERLAKFMKTEEAIIYSYG 167

  Fly   209 FVANDSTLFTLAKLLP-----GCEIFSDAGNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQ-- 266
            |       .|:|..:|     |..:|.|:....::..|::.|.....:|:||||..|.:|||:  
  Rat   168 F-------STIASAIPAYSKRGDIVFVDSAACFAIQKGLQASRSDIKLFKHNDVADLERLLKEQE 225

  Fly   267 -TDKSVPK--------IVAFETVHSMTGAICPLEELLDVAHEHGAITFIDEVHAVGLYGDHGAGV 322
             .|:..|:        ||| |.::..||.||||.||:.:.:::.|..|::|..:.|:.|:||.||
  Rat   226 IEDQKNPRKARVTRRFIVA-EGLYMNTGTICPLPELVRLKYKYKARIFLEESLSFGVLGEHGRGV 289

  Fly   323 GERDGV-LHKMDIISGTLGKAFGNIGGYIAGTHNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVN 386
            .|..|: :..:|:||..:..|..::||:..|...:||..|....|:.|:.||||.:...|:||:|
  Rat   290 TEHYGISIDDIDLISANMENALASVGGFCCGRSFVVDHQRLSGQGYCFSASLPPLLAAAAIEALN 354

  Fly   387 ILASEEG------RQLRHLHQ--RNVSYLK----SLLKREGFPVEETPSHIIPIKIGDPLKSSQI 439
            |:....|      ::.:.:|:  :.||.||    ||.......:||:        .|...:..::
  Rat   355 IMEENPGIFAVLKKKCQTIHKSLQGVSGLKVVGESLCPALHLQLEES--------TGSRERDMKL 411

  Fly   440 SNVLIEQ 446
            ...::||
  Rat   412 LQEIVEQ 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlasNP_477281.1 AAT_I 93..495 CDD:302748 98/332 (30%)
BioF 95..490 CDD:223234 98/332 (30%)
Sptlc1NP_001101876.1 Beta_elim_lyase 11..472 CDD:354370 98/332 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.