DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alas and lace

DIOPT Version :9

Sequence 1:NP_477281.1 Gene:Alas / 37815 FlyBaseID:FBgn0020764 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001285957.1 Gene:lace / 34910 FlyBaseID:FBgn0002524 Length:597 Species:Drosophila melanogaster


Alignment Length:452 Identity:113/452 - (25%)
Similarity:212/452 - (46%) Gaps:56/452 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 YERFFNEQIMKKKRDHSYRVFKKV--------NRLAGDGLFPHALEYSERTEKPITVWCSNDYLG 151
            :|.|::..:.::.:|...|....|        :|:..|  :..:.::: .||.......|.:|||
  Fly   164 FESFYSRYVYRRIKDCWNRPICSVPGDELTLKDRVTDD--YGWSFKFT-GTETRCLNLGSYNYLG 225

  Fly   152 MSAHPGVKRAVQDALNRHGSGAG--GTRNISGNSLHHERLESKLAELHQKEAALLFTSCFVANDS 214
            .:|..| :.|.....:...||..  .:|...|::...:.||:..|.....|.|::|...|..|..
  Fly   226 FAAATG-QCADDSEESARSSGLAYCSSRCELGDNEQLQELEALTARYFGVEDAIVFGMGFATNAL 289

  Fly   215 TLFTLAKLLPGCEIFSDAGNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQ------------- 266
            .|.:|  |.|...:.||..||||:|:|:|.||....:|:||::..|.::|:|             
  Fly   290 NLPSL--LGPNSLVISDEKNHASIILGLRLSGATTKVFKHNNMRDLERVLRQGVCYGNPKKGGQP 352

  Fly   267 TDKSVPKIVAFETVHSMTGAICPLEELLDVAHEHGAITFIDEVHAVGLYGDHGAGVGERDGVLHK 331
            .||   .::..|.:.||.|:|..|.|::.:..::.|..::||.|:||..|..|.||.:...|..|
  Fly   353 WDK---VMILVEGIFSMEGSIVRLPEVIALKKKYKAYLYLDEAHSVGAMGSRGRGVTDYFNVDPK 414

  Fly   332 -MDIISGTLGKAFGNIGGYIAGTHNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVNILASEEGRQ 395
             :||:.||..|:||:.|||:||:..|:|.:|:.:....:..|:.|.:....|.::..:..|:|..
  Fly   415 EVDILMGTFTKSFGSAGGYLAGSKKLIDFLRTNSHAHCYAASISPPIAQQILTSMKTIMGEDGTD 479

  Fly   396 L--RHLHQ--RNVSYLKSLLKREG---FPVEETPSHIIPI------KIGDPLKSSQISNVLIEQF 447
            :  :.:||  ||..|.:..|.:.|   :..|::|  ::|:      |||..:::....::.....
  Fly   480 IGRKKIHQLARNTRYFRRRLAQLGVITYGHEDSP--VVPMLVYLFSKIGAVVRTLTTRHIAAVGA 542

  Fly   448 GHYLQSINYPTVARGQEKLRLAPTPFHTFEMMNALVTDLKKVWEMVDLS-TNVPLSPNACMF 508
            |       :|.....:.::|...:..||.|.::..:..:.::.:.:.|. :..|..||..::
  Fly   543 G-------FPATPIMEGRIRFCLSAAHTKEQLDFALEAIDEIADDLGLKYSRKPRDPNPVIY 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlasNP_477281.1 AAT_I 93..495 CDD:302748 109/436 (25%)
BioF 95..490 CDD:223234 109/431 (25%)
laceNP_001285957.1 PLN02483 117..587 CDD:178101 110/440 (25%)
BioF 164..577 CDD:223234 109/430 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453112
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0156
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13693
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.