DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alas and GCAT

DIOPT Version :9

Sequence 1:NP_477281.1 Gene:Alas / 37815 FlyBaseID:FBgn0020764 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_016884163.1 Gene:GCAT / 23464 HGNCID:4188 Length:521 Species:Homo sapiens


Alignment Length:473 Identity:131/473 - (27%)
Similarity:218/473 - (46%) Gaps:100/473 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 NEQIMKKKRDHSYRVFKKVNRLAGDGLFP-----------HALEYSERTEKPITVWCSNDYLGMS 153
            :|:::..::....|| ..|:...|..:||           |.|.::    ..|..:|:|:|||:|
Human    46 SERVITSRQGPHIRV-DGVSGGPGTVIFPGLPLPHLSCCIHLLSFT----SGILNFCANNYLGLS 105

  Fly   154 AHPGVKRAVQDALNRHGSGAGGTRNISGNSLHHERLESKLAELHQKEAALLFTSCFVANDSTLFT 218
            :||.|.:|...||...|:|....|.|.|....|:.||:|:|..||:|.|:|:.||:.||.....:
Human   106 SHPEVIQAGLQALEEFGAGLSSVRFICGTQSIHKNLEAKIARFHQREDAILYPSCYDANAGLFES 170

  Fly   219 LAKLLPGCE-------------------------------------------------------- 227
            .|.:.||.|                                                        
Human   171 RALVQPGTETRGPQREAQNTLPLYPEERPGWQYSFLICWSPGQGRSPGWLNDGSTLTASLQALLT 235

  Fly   228 ----IFSDAGNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQTDKSVPKIVAFETVHSMTGAIC 288
                :.||..||||:|.|||.....|:.:||.|:..|...|::..|...::||.:...||.|.|.
Human   236 PEDAVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLQEAQKHRLRLVATDGAFSMDGDIA 300

  Fly   289 PLEELLDVAHEHGAITFIDEVHAVGLYGDHGAGVGERDGVLHKMDIISGTLGKAFGNI-GGYIAG 352
            ||:|:..:|..:||:.|:||.||.|..|..|.|..|..||:.::.||:.|||||.|.. |||..|
Human   301 PLQEICCLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTG 365

  Fly   353 THNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVNILA-----------------SEEGRQLRHLH 400
            ...||.::|..|..::|:.||||.|:..|.:|:::|.                 |::||.     
Human   366 PGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRCDSQQGRL----- 425

  Fly   401 QRNVSYLKSLLKREGFPVEETPSHIIPIKIGDPLKSSQISNVLIEQFGHYLQSINYPTVARGQEK 465
            ....::.:|.::..||.:......|.|:.:||...:|::::.:::: |.::...:||.|.:|:.:
Human   426 GGGETWFRSKMEAAGFTISGASHPICPVMLGDARLASRMADDMLKR-GIFVIGFSYPVVPKGKAR 489

  Fly   466 LRLAPTPFHTFEMMNALV 483
            :|:..:..|:.|.::..|
Human   490 IRVQISAVHSEEDIDRCV 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlasNP_477281.1 AAT_I 93..495 CDD:302748 131/473 (28%)
BioF 95..490 CDD:223234 131/473 (28%)
GCATXP_016884163.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58214
OrthoDB 1 1.010 - - D930001at2759
OrthoFinder 1 1.000 - - FOG0000902
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100359
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R554
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.