DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alas and sptl-3

DIOPT Version :9

Sequence 1:NP_477281.1 Gene:Alas / 37815 FlyBaseID:FBgn0020764 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001256547.1 Gene:sptl-3 / 179884 WormBaseID:WBGene00011932 Length:521 Species:Caenorhabditis elegans


Alignment Length:419 Identity:120/419 - (28%)
Similarity:196/419 - (46%) Gaps:50/419 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DHSYRVFKK-VNR-LAGDGLFPHAL-----EYSE---------RTEKPITVWCSNDYLGMSAHPG 157
            ||.||.... ||| ::|   .|.|:     .|::         .||..:....|.:|||.|...|
 Worm   100 DHIYRQSTDVVNRPISG---VPGAIVRLKDRYTDDHGWTQKYTGTESEVINLGSYNYLGFSHRSG 161

  Fly   158 V-KRAVQDALNRHGSGAGGTRNISGNSLHHERLESKLAELHQKEAALLFTSCFVANDSTLFTLAK 221
            | ..|....::::|...||:|...||.:.|:.:||.:|:....|.|::|...|..|...:.:|..
 Worm   162 VCAEAAAAHIDKYGINCGGSRQEIGNHVAHKSVESTIAQYLNVEDAIVFPMGFATNSMNIPSLVD 226

  Fly   222 LLPGCEIFSDAGNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQTDKSV-PK--------IVAF 277
              .|..|.||..||||::.|.|.||....:|||||.....:.|:.....| ||        ::..
 Worm   227 --KGSLILSDRLNHASLVTGCRLSGAHTVVFRHNDASDCERKLRDALCGVSPKTGEKYNKVLIII 289

  Fly   278 ETVHSMTGAICPLEELLDVAHEHGAITFIDEVHAVGLYGDHGAGVGE------RDGVLHKMDIIS 336
            |.::||.|.|..|...:.|..::....|:||.|::|..|..|.||.|      ||     :||:.
 Worm   290 EGIYSMEGTIVNLPAFIAVKKKYNCYLFLDEAHSIGAVGPSGRGVAEYWGCNPRD-----IDIMM 349

  Fly   337 GTLGKAFGNIGGYIAGTHNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVNILASEE----GRQLR 397
            |||.|:|.:.|||:.|:..::|.||.|:||..:..::.|.::.....||.|::.::    |||..
 Worm   350 GTLTKSFASAGGYMGGSKKVIDHIRRYSAGTCYGVTMSPPLIAQVERAVLIMSGKDGTDIGRQKA 414

  Fly   398 HLHQRNVSYLKSLLKREGFPV-EETPSHIIPIKIGDPLKSSQIS-NVLIEQFGHYLQSINYPTVA 460
            .....|..|.:..|::.||.| ....|.::|:......|..:.| .:|....|  :.::.||...
 Worm   415 IQLLENSRYFRKELRKRGFLVYGNNDSPVVPLMTFYITKVVEFSRRMLKHNIG--IVAVGYPATP 477

  Fly   461 RGQEKLRLAPTPFHTFEMMNALVTDLKKV 489
            ..:.::|...:..||.|.::.::..:::|
 Worm   478 LLEARVRFCLSADHTKEHLDYILEAVEQV 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlasNP_477281.1 AAT_I 93..495 CDD:302748 120/419 (29%)
BioF 95..490 CDD:223234 120/419 (29%)
sptl-3NP_001256547.1 PLN02483 87..514 CDD:178101 120/419 (29%)
BioF 123..507 CDD:223234 110/393 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.