DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alas and sptlc2

DIOPT Version :9

Sequence 1:NP_477281.1 Gene:Alas / 37815 FlyBaseID:FBgn0020764 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_002938915.2 Gene:sptlc2 / 100380000 XenbaseID:XB-GENE-946143 Length:553 Species:Xenopus tropicalis


Alignment Length:455 Identity:123/455 - (27%)
Similarity:215/455 - (47%) Gaps:51/455 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KASAKETFP----YERFFNEQIMKKKRDHSYRVFKKV--------NRLAGDGLFPHALEYSERTE 138
            :...|:..|    :|.|:...:..:.||:..|....|        .|...|  :....:::.|..
 Frog    96 RVEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPVCSVPGERIDVMERFTDD--YNWTFKFTGRVI 158

  Fly   139 KPITVWCSNDYLGMSAHPG-VKRAVQDALNRHGSGAGGTRNISGNSLHHERLESKLAELHQKEAA 202
            |.:....|.:|||.:.:.| ...|...:||::|:|...||...||...||.||..:|.....|||
 Frog   159 KGVINMGSYNYLGFAQNTGFCADASAKSLNQYGAGMCSTRQEIGNMEKHEELEHLVARFLGVEAA 223

  Fly   203 LLFTSCFVANDSTLFTLAKLLPGCEIFSDAGNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLK-- 265
            :.:...|..|...:..|..  .||.|.||..||:|:::|.|.||....||:||::..|.:||:  
 Frog   224 MTYGMGFATNSMNIPALVG--KGCLILSDELNHSSLVLGARLSGATIRIFKHNNMQSLEKLLRDA 286

  Fly   266 ------QTDKSVPKI-VAFETVHSMTGAICPLEELLDVAHEHGAITFIDEVHAVGLYGDHGAGVG 323
                  :|.:...|| :..|.::||.|:|..|.|::.:..::.|..::||.|::|..|.:|.||.
 Frog   287 IVQGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPNGRGVV 351

  Fly   324 ERDGV-LHKMDIISGTLGKAFGNIGGYIAGTHNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVNI 387
            :..|: ...:||:.||..|:||:.||||.|:..|::.:|:::....:.||:...|:...:.::..
 Frog   352 DYFGLDPRDVDIMMGTFTKSFGSAGGYIGGSKVLIEYLRAHSHSAAYATSMSLPVVQQIISSMKC 416

  Fly   388 LASEEGRQL--RHLHQ--RNVSYLKSLLKREGFPV-EETPSHIIPIKIGDPLKSSQISNVLIEQF 447
            :..|:|..|  :.:.|  .|..|.:..|...||.: ..:.|.::|:.:..|.|        |..|
 Frog   417 IMGEDGTTLGQKRVEQLAENTRYFRRRLTEMGFIIYGNSDSPVVPLMLYMPAK--------IGAF 473

  Fly   448 GHYLQSINYPTVARG-------QEKLRLAPTPFHTFEMMNALVTDLKKVWEMVDLSTN----VPL 501
            |..:...|...|..|       :.:.|...:..||.||::|.:.::.:|.:::.|..:    |||
 Frog   474 GREMLKRNIGVVVVGFPATPIIESRARFCVSAAHTKEMLDAALREINEVGDLLQLKYSRHHFVPL 538

  Fly   502  501
             Frog   539  538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlasNP_477281.1 AAT_I 93..495 CDD:302748 118/436 (27%)
BioF 95..490 CDD:223234 116/425 (27%)
sptlc2XP_002938915.2 PLN02483 58..536 CDD:178101 120/451 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.