DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fmo-1 and AT1G63390

DIOPT Version :9

Sequence 1:NP_611859.1 Gene:Fmo-1 / 37814 FlyBaseID:FBgn0034943 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001319303.1 Gene:AT1G63390 / 842645 AraportID:AT1G63390 Length:168 Species:Arabidopsis thaliana


Alignment Length:145 Identity:50/145 - (34%)
Similarity:76/145 - (52%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VCIIGAGTAGLCCARHSIANGFETTVFELSDRIGGTWVYN----------EATGAVNGIDVHSSM 58
            |.:||||.|||..||.....|....|||...::||||:|.          :.|.:|    ||||:
plant    13 VAVIGAGAAGLVAARELRREGHSVVVFERQKQVGGTWIYTDHIEPDPLSVDPTRSV----VHSSV 73

  Fly    59 YKNLRTNLPKEVMGFPDFEI----GANEA----SYVRSDEICDFLNQYANHFDLKKHIKFDSYVI 115
            |.:||||||:|.||:.||..    |.:|:    .:....|:..:|..:|..|.:::.|:||:.|:
plant    74 YGSLRTNLPRECMGYRDFPFVVRSGVSESRDPRRFPSHGEVLAYLQDFAKEFAIEEMIRFDTAVV 138

  Fly   116 RVL----QRKTKWQV 126
            :|.    :...||::
plant   139 KVAPAAEEGSGKWRI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fmo-1NP_611859.1 NADB_Rossmann 5..197 CDD:304358 49/144 (34%)
NADB_Rossmann 185..>211 CDD:304358
AT1G63390NP_001319303.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 150 1.000 Domainoid score I1415
eggNOG 1 0.900 - - E1_COG2072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405736at2759
OrthoFinder 1 1.000 - - FOG0000093
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.