DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fmo-1 and YUC4

DIOPT Version :9

Sequence 1:NP_611859.1 Gene:Fmo-1 / 37814 FlyBaseID:FBgn0034943 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_196693.1 Gene:YUC4 / 831003 AraportID:AT5G11320 Length:411 Species:Arabidopsis thaliana


Alignment Length:350 Identity:71/350 - (20%)
Similarity:118/350 - (33%) Gaps:105/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IIGAGTAGLCCARHSIANGFETTVFELSDRIGGTWVYNEATGAVNGIDVHSSMYKNLRTNLPKEV 70
            |:|||.:||..|......|..:.:.|.:|.:...|              ....|..|:.:|||..
plant    19 IVGAGPSGLAVAACLSNRGVPSVILERTDCLASLW--------------QKRTYDRLKLHLPKHF 69

  Fly    71 MGFPDFEIGANEASYVRSDEICDFLNQYANHFDLK-------KHIKFDSYVIRVLQRKTKWQVLF 128
            ...|......|...|........::..||..|::|       :..:||       .....|.|..
plant    70 CELPLMPFPKNFPKYPSKQLFISYVESYAARFNIKPVFNQTVEKAEFD-------DASGLWNVKT 127

  Fly   129 KDLVTNKIEFQYFDKVLVANGHYHTPNYSQIPNMERFKGQFLHSHDFRSREVFEGKSVLVIGAGP 193
            :|.|...      ..::||.|....|.:..||.:::|.|..:|:..::|...|..:.|||:|.|.
plant   128 QDGVYTS------TWLVVATGENAEPVFPNIPGLKKFTGPVVHTSAYKSGSAFANRKVLVVGCGN 186

  Fly   194 SGMDLS----------NIISRTA------------------------------------------ 206
            |||::|          :::.|.:                                          
plant   187 SGMEVSLDLCRYNALPHMVVRNSVHVLPRDFFGLSTFGIAMTLLKWFPLKLVDKFLLLLANSTLG 251

  Fly   207 -----------------DRVTISHHLTDIGQHSFFENVQQK--PDVRELDEKGAFFVDGSYQEFD 252
                             ..||....:.|:|..|...:.|.|  ..|:|:...||.|::|...|||
plant   252 NTDLLGLRRPKTGPIELKNVTGKTPVLDVGAISLIRSGQIKVTQAVKEITRNGAKFLNGKEIEFD 316

  Fly   253 TVFFCTGYKYAFPFLTVDSGIYVED 277
            ::...||||...|....::..:.::
plant   317 SIILATGYKSNVPDWLKENSFFTKE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fmo-1NP_611859.1 NADB_Rossmann 5..197 CDD:304358 47/197 (24%)
NADB_Rossmann 185..>211 CDD:304358 11/94 (12%)
YUC4NP_196693.1 CzcO 18..386 CDD:224983 71/349 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405736at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43539
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X69
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.