DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fmo-1 and Foxred2

DIOPT Version :9

Sequence 1:NP_611859.1 Gene:Fmo-1 / 37814 FlyBaseID:FBgn0034943 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001178716.1 Gene:Foxred2 / 315112 RGDID:1306763 Length:665 Species:Rattus norvegicus


Alignment Length:350 Identity:76/350 - (21%)
Similarity:121/350 - (34%) Gaps:95/350 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CIIGAGTAGLCCAR--HSIANGFETTVFELSDRIGGTW-----------VYNEATGAVNGIDVHS 56
            |::|||.|||..|.  |.....:|  |||.....|..:           :....||..|......
  Rat    25 CVLGAGPAGLQMAALLHRAGRDYE--VFERESAPGSFFTRYPRHRKLISINKRYTGKANAEFNLR 87

  Fly    57 SMYKNLRTNLPKEVMG------FPDFEIGANEASYVRSDEICDFLNQYANHFDLKKHIKFDSYVI 115
            ..:.:|.::.|..:..      |||            :.::..:|..:|....|:  :.:::.:.
  Rat    88 HDWNSLLSDDPHLLFRHYSQAYFPD------------ASDMVRYLGDFAQRLGLR--VLYNTNIT 138

  Fly   116 RVLQRK--TKWQVLFKDLVTNKIEFQYFDKVLVANGHYHTPNYSQIPNMERFKGQFLHSHDFRSR 178
            .|...|  ..|...:..|...|.:......:|||.| ...|.....|..|..:|....|.|   .
  Rat   139 HVTLDKDPQAWNGHYFILRDQKGQVYQCSVLLVATG-LAVPKLVDFPGSEYVEGYESVSVD---P 199

  Fly   179 EVFEGKSVLVIGAGPSGMDLS-NIISRT-------ADRVTIS---HHLTDIG--QHSFFENVQQK 230
            |.|.|::||::|.|.|..:.: ||:..|       ..||.:|   |::.|:.  .:...:..|.|
  Rat   200 EDFVGQNVLILGHGNSAFETAENILGVTNFVHMLSRSRVRLSWATHYVGDVRAINNGLLDTYQLK 264

  Fly   231 -------PDVREL----DEKGAFFV-------DGSYQE-------------------FDTVFFCT 258
                   .|:..|    |.||.|.:       :.|.|.                   :|.|..|.
  Rat   265 SLDGLLESDLEYLALVKDSKGKFHITLKFLLENSSNQSADSIPLPQDDNDNFAMRVAYDRVIRCL 329

  Fly   259 GYKYAFPF----LTVDSGIYVEDNY 279
            |:|:.|..    |.:.||......|
  Rat   330 GWKFDFSIFNQSLRLSSGTEFSKKY 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fmo-1NP_611859.1 NADB_Rossmann 5..197 CDD:304358 48/212 (23%)
NADB_Rossmann 185..>211 CDD:304358 10/33 (30%)
Foxred2NP_001178716.1 CzcO 17..>236 CDD:224983 51/230 (22%)
Pyr_redox_3 25..240 CDD:290456 53/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.