DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16787 and AT1G79510

DIOPT Version :9

Sequence 1:NP_611857.3 Gene:CG16787 / 37811 FlyBaseID:FBgn0034940 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_565211.1 Gene:AT1G79510 / 844289 AraportID:AT1G79510 Length:275 Species:Arabidopsis thaliana


Alignment Length:249 Identity:52/249 - (20%)
Similarity:94/249 - (37%) Gaps:62/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QKLLNSHAANNLQQSRRAYE------------STKAERLPGNPKENERKPEDLDR---------- 84
            :|.:::.|.::...|..:||            |.:|.. |....:.:.||...|:          
plant    22 EKPISNQALSSSSSSSNSYEFEEDSLSPLSLFSVQAPP-PVRGAQVKTKPSAQDKYQHGSKDDFY 85

  Fly    85 -----AYEVLRTTLPKLFVEPLDYSIYSPGLIFHNNITGKHTV-GLYHYVKQIAILRTVGHLKYA 143
                 |...||..||.||.:.|:|.||...:..   :...:|. |:.:|......||..|.:.:.
plant    86 INLGLAVRTLREDLPLLFTKDLNYDIYRDDITL---VDPMNTFSGIDNYKLIFWALRFHGKILFR 147

  Fly   144 YVKFEVLKITKHQDDYTVRIRWRVRGISGLKVMFQFWKYKLWQLKEVLKDQEAWYDGYSVCYLGD 208
            .:..|:.::.:..:: .:.|||.::|:..:.          |:.|       ..:.|.|...|..
plant   148 DISLEIFRVWQPSEN-MILIRWNLKGVPRVP----------WEAK-------GEFQGTSRYKLDR 194

  Fly   209 DGLIVKHVVDKV---MPDESREAVE-NPSATALPP--------GSLAATSSQKI 250
            :|.|.:|.||.:   .|.:.:.|.. ....||.|.        |::.:.||..|
plant   195 NGKIYEHKVDNLAFNFPHQLKPATSVLDMVTACPASPNPTFMFGAMDSYSSSWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16787NP_611857.3 DUF2358 83..215 CDD:287193 30/147 (20%)
AT1G79510NP_565211.1 DUF2358 89..201 CDD:370865 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201653at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.