DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16787 and AT2G46220

DIOPT Version :9

Sequence 1:NP_611857.3 Gene:CG16787 / 37811 FlyBaseID:FBgn0034940 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_566066.1 Gene:AT2G46220 / 819229 AraportID:AT2G46220 Length:241 Species:Arabidopsis thaliana


Alignment Length:217 Identity:48/217 - (22%)
Similarity:84/217 - (38%) Gaps:57/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NSHAANNLQQSRRAYEST-KAERLPG--NPK--------------------ENERKPED------ 81
            ||...:::...|:|..|. .|..|||  |||                    |.|.:.||      
plant    22 NSSVISHVFMRRKATVSAIDARDLPGVKNPKSRLYWQFSAPVKEDYKISREEEEEEEEDKQSYYV 86

  Fly    82 -LDRAYEVLRTTLPKLFVEPLDYSIYSPGLIFHNNITGKHTVGLYHYVKQIAILRTVGHLKYAYV 145
             :..|...:|...|.||.:.|::.||...::|.:.:  ...:|:.:|......||..|.:.:..:
plant    87 NMGHAVRSIREEFPLLFYKELNFDIYRDDIVFKDPM--NTFMGIDNYKSIFGALRFHGRIFFRAL 149

  Fly   146 KFEVLKITKHQDDYTVRIRWRVRGISGLKVMFQFWKYKLWQLKEVLKDQEAWYDGYSVCYLGDDG 210
            ..:::.:.:..:: |:.|||.|.||          ....|:.:       ..:||.|......:|
plant   150 CVDIVSVWQPTEN-TLMIRWTVHGI----------PRGPWETR-------GRFDGTSEYKFDKNG 196

  Fly   211 LIVKHVVDKVMPDESREAVENP 232
            .|.:|.||.:       |:.:|
plant   197 KIYEHKVDNI-------AINSP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16787NP_611857.3 DUF2358 83..215 CDD:287193 27/131 (21%)
AT2G46220NP_566066.1 DUF2358 89..201 CDD:370865 27/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201653at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31094
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.070

Return to query results.
Submit another query.