DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16787 and 2310061I04Rik

DIOPT Version :9

Sequence 1:NP_611857.3 Gene:CG16787 / 37811 FlyBaseID:FBgn0034940 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006524938.1 Gene:2310061I04Rik / 69662 MGIID:1916912 Length:408 Species:Mus musculus


Alignment Length:181 Identity:58/181 - (32%)
Similarity:90/181 - (49%) Gaps:21/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PGNPKENERKPEDLDRAYEVLRTTLPKLFVEPLDYSIYSPGLIFHNNITGKHTVGLYHYVKQIAI 133
            |..|..:|...|.|...:|.||..||.||:...||:|||..:.|.|.|....|.|...||..:.:
Mouse   228 PTTPSGDESMEEHLAVMHERLRQELPTLFLRSHDYTIYSMDVEFINEILNIRTKGRTFYVMSLTL 292

  Fly   134 LRTVGHLKYAYVKFEVLKITKHQDDYTVRIRWRVRGISGLKVMFQFWKYKLWQLKEVLKDQEAWY 198
            .|.:....:|..:.|:|::|:|.:::|::.|||:.|:....:..:|::          :|:|..|
Mouse   293 CRFLVWNYFAQFRLEILQLTRHPENWTLQARWRLIGLPIHMLFLRFYR----------RDKEDLY 347

  Fly   199 ---DGYSVCYLGDDGLIVKHVVDKVMPDESREAVENPSATA--LPPGSLAA 244
               |.:|..||...|||.:|.:||:||..|      ||...  |..|:|.|
Mouse   348 RTFDAFSTFYLNSSGLICRHHLDKLMPSHS------PSTPVKKLLVGALVA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16787NP_611857.3 DUF2358 83..215 CDD:287193 41/134 (31%)
2310061I04RikXP_006524938.1 PHA03247 <114..240 CDD:223021 3/11 (27%)
DUF2358 242..367 CDD:370865 41/134 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834098
Domainoid 1 1.000 72 1.000 Domainoid score I9344
eggNOG 1 0.900 - - E1_KOG4457
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201653at2759
OrthoFinder 1 1.000 - - FOG0007419
OrthoInspector 1 1.000 - - oto93923
orthoMCL 1 0.900 - - OOG6_107932
Panther 1 1.100 - - LDO PTHR31094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11421
SonicParanoid 1 1.000 - - X6306
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.