DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16787 and RGD1302996

DIOPT Version :9

Sequence 1:NP_611857.3 Gene:CG16787 / 37811 FlyBaseID:FBgn0034940 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_998775.2 Gene:RGD1302996 / 294231 RGDID:1302996 Length:311 Species:Rattus norvegicus


Alignment Length:178 Identity:56/178 - (31%)
Similarity:89/178 - (50%) Gaps:21/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PKENERKPEDLDRAYEVLRTTLPKLFVEPLDYSIYSPGLIFHNNITGKHTVGLYHYVKQIAILRT 136
            |..::...|.|...:|.||..||.||:...||:|||..:.|.|.|....|.|...||..:.:.|.
  Rat   134 PSGDQSMEEHLAVMHERLRQELPTLFLRSHDYTIYSMDVEFINEILNVRTKGRTFYVMSLTLCRF 198

  Fly   137 VGHLKYAYVKFEVLKITKHQDDYTVRIRWRVRGISGLKVMFQFWKYKLWQLKEVLKDQEAWY--- 198
            :....:|..:.|:|::|:|.:::|::.|||:.|:....:..:|::          :|:|..|   
  Rat   199 LAWNYFAQFRLEILQLTRHPENWTLQARWRLIGLPVHMLFLRFYR----------RDKEDLYRTF 253

  Fly   199 DGYSVCYLGDDGLIVKHVVDKVMPDESREAVENPSATA--LPPGSLAA 244
            |.:|..||...|||.:|.:||:||..|      ||...  |..|:|.|
  Rat   254 DAFSTFYLNSSGLICRHHLDKLMPSHS------PSTPVKKLLVGALVA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16787NP_611857.3 DUF2358 83..215 CDD:287193 41/134 (31%)
RGD1302996NP_998775.2 DUF2358 145..270 CDD:370865 41/134 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337639
Domainoid 1 1.000 74 1.000 Domainoid score I8996
eggNOG 1 0.900 - - E1_KOG4457
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5076
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201653at2759
OrthoFinder 1 1.000 - - FOG0007419
OrthoInspector 1 1.000 - - oto97457
orthoMCL 1 0.900 - - OOG6_107932
Panther 1 1.100 - - LDO PTHR31094
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6306
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.