DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIM74 and Trim50

DIOPT Version :9

Sequence 1:NP_001304744.1 Gene:TRIM74 / 378108 HGNCID:17453 Length:250 Species:Homo sapiens
Sequence 2:XP_006249190.1 Gene:Trim50 / 288596 RGDID:631346 Length:484 Species:Rattus norvegicus


Alignment Length:250 Identity:201/250 - (80%)
Similarity:218/250 - (87%) Gaps:0/250 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAWQVSLLELEDWLQCPICLEVFKESLMLQCGHSYCKGCLVSLSYHLDTKVRCPMCWQVVDGSSS 65
            ||||:::.||:|.||||||||||||.|||||||||||.||.|||.|||:::|||:|.|.||.|||
  Rat     1 MAWQLTVPELQDQLQCPICLEVFKEPLMLQCGHSYCKNCLDSLSEHLDSELRCPVCRQSVDCSSS 65

Human    66 LPNVSLAWVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHHPVTPVSTVCS 130
            .||||||.||:|||||||.||.||||||||||||||||||.||||||||||||||.|||||||.|
  Rat    66 PPNVSLARVIDALRLPGDTEPTVCVHHRNPLSLFCEKDQEFICGLCGLLGSHQHHRVTPVSTVYS 130

Human   131 RMKEELAALFSELKQEQKKVDELIAKLVKNRTRIVNESDVFSWVIRREFQELRHPVDEEKARCLE 195
            |||||||...||||::.:.|:|.|.|||.|||||:|||||||||||||||||.|.||||||||||
  Rat   131 RMKEELAGRLSELKEQHRDVEEHIGKLVNNRTRIINESDVFSWVIRREFQELHHLVDEEKARCLE 195

Human   196 GIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHEFIWKFHSMASR 250
            |:..|||||||||||||||||||:|||||||.||||||||.|||||.||||:.||
  Rat   196 GVESHTRGLVASLDMQLEQAQGTQERLAQAERVLEQFGNESHHEFIRKFHSITSR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIM74NP_001304744.1 RING 15..60 CDD:238093 35/44 (80%)
BBOX 90..125 CDD:237988 32/34 (94%)
Trim50XP_006249190.1 RING 15..60 CDD:238093 35/44 (80%)
BBOX 90..125 CDD:237988 32/34 (94%)
iSH2_PI3K_IA_R 134..>225 CDD:304922 71/90 (79%)
SPRY_PRY_TRIM50 283..471 CDD:293977
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I45153
eggNOG 1 0.900 - - E33208_3BG6H
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D124751at32523
OrthoFinder 1 1.000 - - FOG0008511
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24103
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.