DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIM74 and LOC100536643

DIOPT Version :9

Sequence 1:NP_001304744.1 Gene:TRIM74 / 378108 HGNCID:17453 Length:250 Species:Homo sapiens
Sequence 2:XP_003198215.2 Gene:LOC100536643 / 100536643 -ID:- Length:466 Species:Danio rerio


Alignment Length:247 Identity:60/247 - (24%)
Similarity:108/247 - (43%) Gaps:34/247 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    11 EDWLQCPICLEVFKESLMLQCGHSYCKGCLVSLSYHLDTKVR-CPMCWQVVDGSSSLPNVSLAWV 74
            |:.|.||:|.|:|::.::|.|.||:|:.||.  .:.....:| ||:|.:.....|...|.:|..:
Zfish     7 EEDLSCPVCCEIFQDPVLLPCSHSFCRRCLE--RFWKSALLRSCPVCRRRASKKSPPSNRALKNL 69

Human    75 IEALRL---PGDPEPK--VCVHHRNPLSLFCEKDQELICGLCGLLGSHQHHPVTPVSTVCSRMKE 134
            .||.:|   .|:....  :|..|...|.|||..|||.||.:|.....|:.|..:|........|:
Zfish    70 CEAFQLGKGQGNASGSNLLCWRHGEKLKLFCLVDQEPICVVCQASKMHKGHDCSPTEEAALECKD 134

Human   135 ELAALFSELKQ------EQKKVDELIAKLVKNRTRIVNESDVFSWVIRREFQELRH--------- 184
            ::::....|:|      :.::....|.:.:|.:.:.|...      ::.||.:|..         
Zfish   135 KISSAIMVLQQKLEVFNKARQSSAFILEHIKTQAQRVERQ------MKEEFLKLHQFLYAEEERR 193

Human   185 --PVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAE--CVLEQF 232
              .:.||:.:|:..:.........|:. .|.:...|.|:..:||  .:|:.|
Zfish   194 LSALKEEEEQCVTAVKSRDEDYTRSIG-SLTELINTMEQTLKAEDLTLLQNF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIM74NP_001304744.1 RING 15..60 CDD:238093 16/45 (36%)
BBOX 90..125 CDD:237988 13/34 (38%)
LOC100536643XP_003198215.2 RING 12..53 CDD:238093 16/42 (38%)
BBOX 88..124 CDD:237988 14/35 (40%)
SPRY_PRY_TRIM35 291..457 CDD:293950
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D158777at7742
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.