powered by:
Protein Alignment CG3803 and Fdx1
DIOPT Version :9
Sequence 1: | NP_611855.1 |
Gene: | CG3803 / 37809 |
FlyBaseID: | FBgn0034938 |
Length: | 393 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_032022.1 |
Gene: | Fdx1 / 14148 |
MGIID: | 103224 |
Length: | 188 |
Species: | Mus musculus |
Alignment Length: | 61 |
Identity: | 15/61 - (24%) |
Similarity: | 27/61 - (44%) |
Gaps: | 7/61 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 261 VAGLDAGLVYNSF---PKMGDKWIPDDMWTFAPIQKNITENPTTVQFNHRILGISTVTLTT 318
|.|..||...:.: |::..:..|....:.:...::.:|:..||.|.:| ...||||
Mouse 29 VCGTGAGTAISPWTPSPRLHAEAGPGRPLSVSARARSSSEDKITVHFKNR----DGETLTT 85
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R421 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.