powered by:
Protein Alignment CG3803 and FDX2
DIOPT Version :9
Sequence 1: | NP_611855.1 |
Gene: | CG3803 / 37809 |
FlyBaseID: | FBgn0034938 |
Length: | 393 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001026904.2 |
Gene: | FDX2 / 112812 |
HGNCID: | 30546 |
Length: | 186 |
Species: | Homo sapiens |
Alignment Length: | 50 |
Identity: | 14/50 - (28%) |
Similarity: | 23/50 - (46%) |
Gaps: | 10/50 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 GVSGMVFVAVGLG------GVTRLTESGLSMVT---WKLTGERMPRTQEE 94
|||..|.:....| |.|..:..|:::.| ::.||.| |..:|:
Human 12 GVSARVLLQAARGTWWNRPGGTSGSGEGVALGTTRKFQATGSR-PAGEED 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R421 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.