DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzr2 and cdc20b

DIOPT Version :9

Sequence 1:NP_611854.1 Gene:fzr2 / 37808 FlyBaseID:FBgn0034937 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_004910413.1 Gene:cdc20b / 100497347 XenbaseID:XB-GENE-1013871 Length:519 Species:Xenopus tropicalis


Alignment Length:292 Identity:115/292 - (39%)
Similarity:164/292 - (56%) Gaps:8/292 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LQDDFYLNLIDWSSKNTLAVGLGCSVYLWSAVSGQVTRLCDFNNEDNLITAVSWHGEGRQVAIGT 206
            |.:|:||||:||:|:|.:|:||..:.|::|..:..||:....:.....:::|||...|..:||||
 Frog   227 LHNDYYLNLLDWNSENLVAIGLKSTAYIFSGENRTVTQKIHLSCPATYVSSVSWISSGTCLAIGT 291

  Fly   207 QSGYVTIWDAENQKQINRLEEHSARVTALAWCGNRLASGSRDRSILQRDIRNPPTHITRCLRGHK 271
            .||.|.:||.|.||::..:..|.:.|.||:|..:.|:||||...|...|:|....||...  .||
 Frog   292 SSGEVQLWDIETQKRLRNMLGHMSVVGALSWNNHILSSGSRLGHIHHHDVRIAEHHIGTL--QHK 354

  Fly   272 LEVCGLQWSPSNRYLASGGSDNRLLVWTDDWPE-----PIYAFDEHKAVVKALGWSPHKSGLLAS 331
            ..:|.|:|||....||||.||..|.:|..|..|     |:... .|...|||:.|.|..|..||.
 Frog   355 QGICSLKWSPCGNKLASGSSDGDLKIWPCDPGETKLKSPLLNM-PHPTAVKAMNWCPWLSDTLAV 418

  Fly   332 GGGSADRCLRFWNVLTGKLVKCINTGAQISNLAWARDSRELVTTHGHAQPQVIAWRYPSLKQMAR 396
            |||..|..:|.|:..:||.:...||.:||.:|.|...::||:|.||.::.|:..|:||||.:|..
 Frog   419 GGGMTDGLIRIWDTNSGKNIHSANTNSQICSLLWLPQTKELLTGHGPSRNQMTIWQYPSLLKMND 483

  Fly   397 LSGHTQRVLHLSVSPDNESIVTGGADETLRFW 428
            ..||..|||||::|||...|.:..|:.|...|
 Frog   484 YYGHKGRVLHLALSPDQRRIFSAAANGTANIW 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzr2NP_611854.1 WD40 <101..439 CDD:225201 115/292 (39%)
WD40 repeat 149..185 CDD:293791 13/35 (37%)
WD40 190..446 CDD:295369 98/244 (40%)
WD40 repeat 190..227 CDD:293791 16/36 (44%)
WD40 repeat 233..269 CDD:293791 13/35 (37%)
WD40 repeat 274..310 CDD:293791 16/40 (40%)
WD40 repeat 317..355 CDD:293791 15/37 (41%)
WD40 repeat 360..398 CDD:293791 15/37 (41%)
WD40 repeat 404..436 CDD:293791 11/25 (44%)
cdc20bXP_004910413.1 WD40 <220..516 CDD:225201 115/292 (39%)
WD40 repeat 234..270 CDD:293791 13/35 (37%)
WD40 repeat 275..312 CDD:293791 16/36 (44%)
WD40 repeat 318..349 CDD:293791 12/30 (40%)
WD40 repeat 357..396 CDD:293791 16/38 (42%)
WD40 repeat 404..440 CDD:293791 15/35 (43%)
WD40 repeat 447..485 CDD:293791 15/37 (41%)
WD40 repeat 491..517 CDD:293791 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1220675at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.