DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and PHB2

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_011747.2 Gene:PHB2 / 853146 SGDID:S000003463 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:57/254 - (22%)
Similarity:100/254 - (39%) Gaps:74/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RFH----RILDPGLNILVPVADKIKYVQSLKEIAIDV---PKQSAI---TSD----NVT---LSI 106
            |.|    ||.:.|.:.:.|..|        ..|..||   |:..|.   |.|    |:|   ||.
Yeast    72 RIHGVSSRIFNEGTHFIFPWLD--------TPIIYDVRAKPRNVASLTGTKDLQMVNITCRVLSR 128

  Fly   107 DGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINKASE 171
            ..|:.|..|  |: :.|.:..|..:..:....:::.:.:.:..::..:||.::..|.:::.:.:.
Yeast   129 PDVVQLPTI--YR-TLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREKVSRLIRENLVRRAS 190

  Fly   172 AWGIACLRYEIRDIRLP--------TRVHEAMQM-QVEAER----------RKRAAILESEG-VR 216
            .:.|.     :.|:.:.        |...||.|: |.:|:|          .|:..::.::| .:
Yeast   191 KFNIL-----LDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQEKQGMVVRAQGEAK 250

  Fly   217 EAEINIAEGKRKSR----------------ILASEAERQEHINKASGEAAAIIAVADAR 259
            .||: |.|..:|||                ||||...|....|    ||..:..|.|||
Yeast   251 SAEL-IGEAIKKSRDYVELKRLDTARDIAKILASSPNRVILDN----EALLLNTVVDAR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 33/165 (20%)
SPFH_paraslipin 80..188 CDD:259811 22/120 (18%)
Band_7_C 266..326 CDD:292817
PHB2NP_011747.2 SPFH_prohibitin 58..252 CDD:259799 38/195 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.