DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and PHB1

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_011648.3 Gene:PHB1 / 853033 SGDID:S000003364 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:66/294 - (22%)
Similarity:116/294 - (39%) Gaps:83/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RILDPGLNILVPVADKIKYVQSLKEIAIDV-PKQSAITSDNVTLSIDGV-LYLRIID-----PYK 119
            :::..|.:.|||      ::|  |.|..|| .|..:|.::..|..:..| |.||::.     ...
Yeast    50 QVVGEGTHFLVP------WLQ--KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLP 106

  Fly   120 ASY---GVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINKASEAWGIACLRYE 181
            |.|   |::..|..:..:....::|.:.:....::..:||.::..|...::..:..:||     :
Yeast   107 AIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGI-----K 166

  Fly   182 IRDIRLP--------TRVHEAMQM-QVEAERRKRAAILESEGVREAEINIAEGKRKSRILASEAE 237
            :.|:.:.        |:..|..|: |.:|||.| ..:.::|..|:|.:..|||         |||
Yeast   167 LEDVSITHMTFGPEFTKAVEQKQIAQQDAERAK-FLVEKAEQERQASVIRAEG---------EAE 221

  Fly   238 RQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFKKLAKTNNTMI 302
            ..|.|:|      |:..|.|    .||.|.:.        .||..:|:       .||.::|.:.
Yeast   222 SAEFISK------ALAKVGD----GLLLIRRL--------EASKDIAQ-------TLANSSNVVY 261

  Fly   303 LPSNPGDVNGFVAQALAVYNHVSNSNQATKSSEN 336
            |||                .|....|..:..|.|
Yeast   262 LPS----------------QHSGGGNSESSGSPN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 30/155 (19%)
SPFH_paraslipin 80..188 CDD:259811 23/117 (20%)
Band_7_C 266..326 CDD:292817 11/59 (19%)
PHB1NP_011648.3 SPFH_prohibitin 29..223 CDD:259799 44/195 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.