DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and HIR1

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_201080.1 Gene:HIR1 / 836395 AraportID:AT5G62740 Length:286 Species:Arabidopsis thaliana


Alignment Length:287 Identity:66/287 - (22%)
Similarity:126/287 - (43%) Gaps:31/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CVMFVPQQEAWVVERMGRFHRILDPGLNILVP--VADKIKYVQSLKEIAIDVPKQSAITSDNVTL 104
            |.:.|.|....:.|..|:|..:|:||.:.| |  :..::....||:...:||..::. |.|||.:
plant     6 CCVQVDQSTVAIKETFGKFEDVLEPGCHFL-PWCLGSQVAGYLSLRVQQLDVRCETK-TKDNVFV 68

  Fly   105 SIDGVLYLRII-----DPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVD 164
            ::...:..|.:     |.|   |.:.:....|.......:|:.:.|:.:|.||.::..:..::.:
plant    69 NVVASIQYRALANKANDAY---YKLSNTRGQIQAYVFDVIRASVPKLLLDDVFEQKNDIAKAVEE 130

  Fly   165 SINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKS 229
            .:.||..|:|...::..|.||.....|..||.....|.|.:.||..::|..:..:|..|||:.:|
plant   131 ELEKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARMRLAANEKAEAEKILQIKRAEGEAES 195

  Fly   230 RILAS---EAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAF 291
            :.|:.   ..:||              |:.|....|:|..|.::.....::...:.|..||....
plant   196 KYLSGLGIARQRQ--------------AIVDGLRDSVLGFAVNVPGTTAKDVMDMVLVTQYFDTM 246

  Fly   292 KKL--AKTNNTMILPSNPGDVNGFVAQ 316
            |::  :..::.:.:|..||.|....:|
plant   247 KEIGASSKSSAVFIPHGPGAVRDVASQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 39/163 (24%)
SPFH_paraslipin 80..188 CDD:259811 25/112 (22%)
Band_7_C 266..326 CDD:292817 10/53 (19%)
HIR1NP_201080.1 SPFH_like_u4 10..278 CDD:259805 65/283 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43327
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.