DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and HIR2

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_566135.1 Gene:HIR2 / 821309 AraportID:AT3G01290 Length:285 Species:Arabidopsis thaliana


Alignment Length:301 Identity:77/301 - (25%)
Similarity:143/301 - (47%) Gaps:32/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CVMFVPQQEAWVVERMGRFHRILDPGLNILVP--VADKIKYVQSLKEIAIDVPKQSAITSDNVTL 104
            |.:.|.|.:..|.||.|:|.::|:|||. .||  :.|.:....:|:...:||..::. |.|||.:
plant     6 CCVLVKQSDVAVKERFGKFQKVLNPGLQ-FVPWVIGDYVAGTLTLRLQQLDVQCETK-TKDNVFV 68

  Fly   105 SIDGVLYLRIIDPYKAS---YGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSI 166
            ::...:..|::.. |||   |.:.:|...|.......:|:.:.|:::|.||.::..:..|:.:.:
plant    69 TVVASIQYRVLAD-KASDAFYRLSNPTTQIKAYVFDVIRACVPKLNLDDVFEQKNEIAKSVEEEL 132

  Fly   167 NKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILE-SEGVREAEINIAEGKRKSR 230
            :||..|:|...|:..|.||....:|..||. ::.|..|.|.|..| :|..:..:|..|||:.:|:
plant   133 DKAMTAYGYEILQTLIIDIEPDQQVKRAMN-EINAAARMRVAASEKAEAEKIIQIKRAEGEAESK 196

  Fly   231 ILAS---EAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFK 292
            .|:.   ..:||              |:.|....|:|..|.::.....::...:.:..||....:
plant   197 YLSGLGIARQRQ--------------AIVDGLRDSVLGFAGNVPGTSAKDVLDMVMMTQYFDTMR 247

  Fly   293 KLAKT--NNTMILPSNPGDVNGFVAQALAVYNHVSNSNQAT 331
            .:..|  ::.:.:|..||.|:...||   :.|.:..:|.|:
plant   248 DIGATSKSSAVFIPHGPGAVSDVAAQ---IRNGLLQANNAS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 46/161 (29%)
SPFH_paraslipin 80..188 CDD:259811 28/110 (25%)
Band_7_C 266..326 CDD:292817 11/61 (18%)
HIR2NP_566135.1 SPFH_like_u4 10..278 CDD:259805 74/288 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43327
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.