DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and stoml1

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001039193.1 Gene:stoml1 / 734047 XenbaseID:XB-GENE-990189 Length:361 Species:Xenopus tropicalis


Alignment Length:137 Identity:36/137 - (26%)
Similarity:64/137 - (46%) Gaps:1/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VPQQEAWVVERMGRFHRILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITSDNVTLSIDGVL 110
            ||..:..|:.|:||......|||.:|.|:.|:.:.| .::..|..||.....:.|.|.:|:...:
 Frog    63 VPDYQRIVIFRLGRVQAARGPGLVLLFPLIDQFQRV-DMRTKAFSVPPSKVKSRDGVLVSMGADI 126

  Fly   111 YLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINKASEAWGI 175
            ...|.||..:...|:|..|.....||..|...||:..:.::..:|..:...:.:.:|:..:.||:
 Frog   127 QFCICDPVLSVLSVQDLNFVTRNTAQNLMTQSLGRKYLREIQNDRARIAEHLKEDLNEQVKPWGL 191

  Fly   176 ACLRYEI 182
            ...|.|:
 Frog   192 CVERVEL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 36/137 (26%)
SPFH_paraslipin 80..188 CDD:259811 24/103 (23%)
Band_7_C 266..326 CDD:292817
stoml1NP_001039193.1 PHB 60..198 CDD:214581 35/135 (26%)
SPFH_SLP-1 75..205 CDD:259814 32/125 (26%)
SCP2 254..357 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.