DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and zgc:112408

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001017597.1 Gene:zgc:112408 / 550260 ZFINID:ZDB-GENE-050417-63 Length:291 Species:Danio rerio


Alignment Length:284 Identity:78/284 - (27%)
Similarity:141/284 - (49%) Gaps:58/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PINM--CVMFVPQQEAWVVERMGRFHRIL----DPGLNILVPVADKIKYVQSLKEIAIDVPKQSA 96
            |:::  |:..|.:.|..|:.|:|   |:|    .|||..::|..|..:.| .|:.::.|:|.|..
Zfish    57 PVSVWFCMKVVQEYERAVIFRLG---RLLGGAKGPGLFWIIPCMDTFRKV-DLRTVSFDIPAQEV 117

  Fly    97 ITSDNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVS 161
            :|.|:||..:|.|:|.||.:|..:...||:..:|...:||||:|:.||..|:..:.::||.::..
Zfish   118 LTKDSVTTMVDAVVYYRIFNPTVSITKVENANYATQMIAQTTLRNMLGTKSLADILKDREEMSEQ 182

  Fly   162 IVDSINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGK 226
            :...:..||:.|||...|.|::|::|||.:..||..:.||.|..||.::.:||..:|        
Zfish   183 MEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDARAKVIAAEGEMKA-------- 239

  Fly   227 RKSRILASEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAF 291
                            ::|..|||.:::                     ::.|:|.|  :|:...
Zfish   240 ----------------SRALKEAANVMS---------------------ESPAALQL--RYMQTL 265

  Fly   292 KKLA-KTNNTMILPSNPGDVNGFV 314
            .::| :.|:|:|.|.....::||:
Zfish   266 TEIASERNSTIIFPVPMDLMSGFM 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 54/163 (33%)
SPFH_paraslipin 80..188 CDD:259811 36/107 (34%)
Band_7_C 266..326 CDD:292817 11/50 (22%)
zgc:112408NP_001017597.1 HflC 44..290 CDD:223407 78/284 (27%)
SPFH_like 83..283 CDD:302763 67/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.