DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and PHB

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001268425.1 Gene:PHB / 5245 HGNCID:8912 Length:272 Species:Homo sapiens


Alignment Length:244 Identity:58/244 - (23%)
Similarity:98/244 - (40%) Gaps:66/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RFHRILD----PGLNILVPVADKIKYVQSLKEIAID-------VPKQSAITSD------NVTLSI 106
            ||..:.|    .|.:.|:|      :||  |.|..|       ||   .||..      |:||.|
Human    41 RFRGVQDIVVGEGTHFLIP------WVQ--KPIIFDCRSRPRNVP---VITGSKDLQNVNITLRI 94

  Fly   107 DGVLYLRIIDPYK---ASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINK 168
               |:..:.....   .|.|.:..|..:..:....::|.:.:....::..:||.::..:.|.:.:
Human    95 ---LFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTE 156

  Fly   169 ASEAWGIACLRYEIRDIRLP--------TRVHEAMQM-QVEAER----------RKRAAILESEG 214
            .:..:|:.     :.|:.|.        |...||.|: |.||||          :|:|||:.:||
Human   157 RAATFGLI-----LDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEG 216

  Fly   215 VREAEINIAEGKRKSRILASEAERQEHINKASGEAAAIIAVADARARSL 263
            ..:|...||..      ||:..:....:.|.  |||..||...:|:|::
Human   217 DSKAAELIANS------LATAGDGLIELRKL--EAAEDIAYQLSRSRNI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 34/168 (20%)
SPFH_paraslipin 80..188 CDD:259811 23/123 (19%)
Band_7_C 266..326 CDD:292817
PHBNP_001268425.1 SPFH_prohibitin 27..221 CDD:259799 45/198 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.