DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and l(2)37Cc

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster


Alignment Length:256 Identity:56/256 - (21%)
Similarity:100/256 - (39%) Gaps:55/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ILDPGLNILVPVADKIKYVQSLKEIAIDVPKQ----SAITSD------NVTLSIDGVLYLRIIDP 117
            ::..|.:..:|      :||  :.|..|:..|    ..||..      |:||.|   ||..|.|.
  Fly    49 VVGEGTHFFIP------WVQ--RPIIFDIRSQPRNVPVITGSKDLQNVNITLRI---LYRPIPDQ 102

  Fly   118 YKASY---GVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINKASEAWGIACLR 179
            ....|   |.:..|..:..:|...:::.:.:....::..:||.::..:...:...::.:|     
  Fly   103 LPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFG----- 162

  Fly   180 YEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKSRILASEAERQEHINK 244
            :.:.||.| |.:....:..:..|.::.|.       :|||        |:|.:..:||:|:    
  Fly   163 FILDDISL-THLTFGREFTLAVEMKQVAQ-------QEAE--------KARFVVEKAEQQK---- 207

  Fly   245 ASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFKKLAKTNNTMILPS 305
               .|:.|.|..||.|..||  |||.... |.....|...|.......:|:::.....|||
  Fly   208 ---LASIISAEGDAEAAGLL--AKSFGEA-GDGLVELRRIEAAEDIAYQLSRSRGVAYLPS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 28/148 (19%)
SPFH_paraslipin 80..188 CDD:259811 24/120 (20%)
Band_7_C 266..326 CDD:292817 10/40 (25%)
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 43/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.