DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and Phb2

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster


Alignment Length:322 Identity:59/322 - (18%)
Similarity:121/322 - (37%) Gaps:76/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AWVVERMGRFHR-ILDPGLNILVPVADKIKYVQSLKEIAIDV---PKQSAITSDNVTLSIDGVLY 111
            |.:..|:|.... |...||::.:|   ..:|     .|..|:   |::.:..:.:..|.:..: .
  Fly    51 AIIFSRLGGIQSDIYSEGLHVRIP---WFQY-----PIIYDIRSRPRKISSPTGSKDLQMINI-S 106

  Fly   112 LRIID-------PY-KASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINK 168
            ||::.       || ....||:..|..:..:....::|.:.|.:..::..:|:.:::.|...:.:
  Fly   107 LRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRKELVE 171

  Fly   169 ASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKSRILA 233
            .:..:.|......:.::........|::.:..|::..:.|:...|..::                
  Fly   172 RARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQ---------------- 220

  Fly   234 SEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTL----AEQYIGAFKKL 294
               |:|:.|.:|.|||.|               ||.|.....||.|.|.|    |.|.|.  :.:
  Fly   221 ---EKQQKIVQAEGEAEA---------------AKMLGLAVKQNPAYLKLRKLRAAQSIA--RTI 265

  Fly   295 AKTNNTMILPSNPGDVN----GFVAQALAVYNHVSN-----------SNQATKSSENVKGVG 341
            |.:.|.:.|.::...:|    ||......||...:.           :::..:.:|..|.||
  Fly   266 ASSQNKVYLSADSLMLNIQDSGFDDMTEKVYKIGTGLPKDWLDARKMASKVAQPAEKEKNVG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 25/159 (16%)
SPFH_paraslipin 80..188 CDD:259811 17/118 (14%)
Band_7_C 266..326 CDD:292817 19/67 (28%)
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 36/227 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.