DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and stoml2

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001004808.1 Gene:stoml2 / 448051 XenbaseID:XB-GENE-1017042 Length:350 Species:Xenopus tropicalis


Alignment Length:321 Identity:204/321 - (63%)
Similarity:260/321 - (80%) Gaps:7/321 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLAGS-------WIPSQSRRGKASTPINMCVMFVPQQEAWVVERMGRFHRILDPGLNILVPVADK 77
            ||.||       |.....|...:..|:|..|:|||||||||:||||||||||:||||:|:|:.|:
 Frog    12 LLRGSQVHYPRTWNREAQRCLSSGLPMNTVVLFVPQQEAWVIERMGRFHRILEPGLNVLIPILDR 76

  Fly    78 IKYVQSLKEIAIDVPKQSAITSDNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSE 142
            |:||||||||.|:||:|||::.|||||.|||||||||:|||||||||||||:|:|||||||||||
 Frog    77 IRYVQSLKEIVINVPEQSAVSLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSE 141

  Fly   143 LGKMSMDKVFRERESLNVSIVDSINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRA 207
            |||:::|||||||||||.:|||:||:||:.|||.||||||:||.:|.:|.|||||||||||||||
 Frog   142 LGKLTLDKVFRERESLNANIVDAINQASDYWGIKCLRYEIKDIHVPPKVKEAMQMQVEAERRKRA 206

  Fly   208 AILESEGVREAEINIAEGKRKSRILASEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSH 272
            .:|||||.||:.||:|||:::::||||||||.|.||||:|||.||:|.|.||..::..:|::|:.
 Frog   207 MVLESEGTRESAINVAEGQKQAQILASEAERAEQINKAAGEANAILAKAKARGDAIRMLAEALTQ 271

  Fly   273 LDGQNAASLTLAEQYIGAFKKLAKTNNTMILPSNPGDVNGFVAQALAVYNHVSNSNQATKS 333
            .:|..|||||:||||:.||.||||.:||::||:|.||::..||||:.:|..::....|..|
 Frog   272 QNGNAAASLTVAEQYVLAFSKLAKESNTILLPTNTGDISSMVAQAMGIYGKMTQQQLAQSS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 120/157 (76%)
SPFH_paraslipin 80..188 CDD:259811 85/107 (79%)
Band_7_C 266..326 CDD:292817 30/59 (51%)
stoml2NP_001004808.1 HflC 45..318 CDD:223407 191/272 (70%)
SPFH_paraslipin 78..188 CDD:259811 85/109 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 282 1.000 Domainoid score I1642
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H8389
Inparanoid 1 1.050 410 1.000 Inparanoid score I1824
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237942at2759
OrthoFinder 1 1.000 - - FOG0003634
OrthoInspector 1 1.000 - - oto103232
Panther 1 1.100 - - LDO PTHR43327
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1864
SonicParanoid 1 1.000 - - X2984
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.