DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and CG31358

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster


Alignment Length:242 Identity:64/242 - (26%)
Similarity:116/242 - (47%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PINMCVMFVPQQE--AWVVERMGRFHRILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITSD 100
            |.::|.......|  ..|:.|:||....|.|||..|:|..|....| .::...::|..|..:|.|
  Fly    45 PFSLCCCLTIAYEFHRLVIFRLGRIRSCLGPGLVFLLPCIDSFNTV-DIRTDVVNVDPQEMLTKD 108

  Fly   101 NVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDS 165
            :|:::::.|::..|.||..:...|:|...|..:::|.|:|:.:|...:.::...|:.|::.|..:
  Fly   109 SVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGLHELLASRQQLSLEIQQA 173

  Fly   166 INKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREA------------ 218
            :.|.:|.||:...|.::.:|.||:.:..::..:.||.|..||.|:.:||..:|            
  Fly   174 VAKITERWGVRVERVDLMEISLPSSLERSLASEAEATREARAKIILAEGEAKASKALKECSDVMS 238

  Fly   219 EINIAEGKRKSRILASEA-ERQEHI--------------NKASGEAA 250
            |..|....|..:||.|.| ||:.::              .|.|.:||
  Fly   239 ENQITLQLRHLQILCSMASERRVNVLFPIPLEIMAPFMDGKDSSDAA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 41/159 (26%)
SPFH_paraslipin 80..188 CDD:259811 26/107 (24%)
Band_7_C 266..326 CDD:292817
CG31358NP_001287292.1 PHB 50..204 CDD:214581 40/154 (26%)
SPFH_like 74..276 CDD:302763 52/202 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473040
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.