DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and stoml3

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_989344.1 Gene:stoml3 / 394970 XenbaseID:XB-GENE-1015871 Length:283 Species:Xenopus tropicalis


Alignment Length:283 Identity:82/283 - (28%)
Similarity:136/283 - (48%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PINM--CVMFVPQQEAWVVERMGRF--HRILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAIT 98
            |:::  ||..:.:.|..||.|:||.  .:...||:..::|..|....| .|:.|:..:|.|..:|
 Frog    47 PLSIWFCVKIIQEYERAVVFRLGRIISGKAKGPGVMFVLPCTDTFIKV-DLRVISFAIPPQEILT 110

  Fly    99 SDNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIV 163
            .|:||.::|||:|..|....||...|.:...|..||||||:|:.||..::..:...||.:..:|.
 Frog   111 KDSVTTTVDGVVYYNIQSAIKAVANVNNVHIATQQLAQTTLRNILGTQTLANILANREEIAHNIQ 175

  Fly   164 DSINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRK 228
            ..::.|:..||:...|.|:||:|||.::..||..:.||.|..||.::.:||    |:|       
 Frog   176 SILDHATHKWGVKVDRVEMRDVRLPVQMQRAMAAEAEAAREARAKVVAAEG----EMN------- 229

  Fly   229 SRILASEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFKK 293
                         .::|..||:.:||.:.|        |..|.:|...|    |:|         
 Frog   230 -------------ASRALKEASLVIAESPA--------ALQLRYLQTLN----TIA--------- 260

  Fly   294 LAKTNNTMILPSNPGDVNGFVAQ 316
             |:.|:|::.|.....:.||:::
 Frog   261 -AENNSTIVFPLPIELMQGFLSR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 54/161 (34%)
SPFH_paraslipin 80..188 CDD:259811 38/107 (36%)
Band_7_C 266..326 CDD:292817 12/51 (24%)
stoml3NP_989344.1 SPFH_like 73..274 CDD:418525 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.