DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and Mec2

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster


Alignment Length:304 Identity:85/304 - (27%)
Similarity:150/304 - (49%) Gaps:56/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 INMCVMFVPQQEAWVVERMGRFH-RILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITSDNV 102
            |.:|...|.:.|..::.|:||.. ....||:..::|..|:.:.| .|:.:..:||:|..:|.|:|
  Fly    85 IFICFKVVAEYERAIIFRLGRLSGGARGPGMFFILPCIDEYRKV-DLRTVTFNVPQQEMLTKDSV 148

  Fly   103 TLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSIN 167
            |:::|.|:|.||.||..|...|||...:...||.||:|:.:|..::.::..|||:|..::..:::
  Fly   149 TVTVDAVVYYRISDPLYAVIQVEDYSMSTRLLAATTLRNIVGTRNLSELLTERETLAHNMQATLD 213

  Fly   168 KASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKSRIL 232
            :|:|.||:...|.||:|:.||..:..||..:.||.|..||.::           .|||::||.  
  Fly   214 EATEPWGVMVERVEIKDVSLPVSMQRAMAAEAEAARDARAKVI-----------AAEGEKKSA-- 265

  Fly   233 ASEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFKKLAKT 297
                       .|..||:.:|:.:.:        |..|.:|  |..:|::            |:.
  Fly   266 -----------TALKEASDVISASPS--------ALQLRYL--QTLSSIS------------AEK 297

  Fly   298 NNTMILPSNPGDVNGFVAQALAVYNHVSNS----NQATKSSENV 337
            |:|:|.|. |.::   :...||.|.|:...    .|:.:.|:|:
  Fly   298 NSTIIFPL-PMEL---LTPYLAKYAHLMGPPPELKQSPEKSDNI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 52/158 (33%)
SPFH_paraslipin 80..188 CDD:259811 38/107 (36%)
Band_7_C 266..326 CDD:292817 15/59 (25%)
Mec2NP_573357.1 PHB 88..238 CDD:214581 50/150 (33%)
SPFH_like 107..314 CDD:302763 71/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473042
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.