DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and phb

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_005163854.1 Gene:phb / 321346 ZFINID:ZDB-GENE-030131-6577 Length:309 Species:Danio rerio


Alignment Length:272 Identity:62/272 - (22%)
Similarity:109/272 - (40%) Gaps:69/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RFHRILD----PGLNILVPVADKIKYVQSLKEIAID-------VPKQSAITSD------NVTLSI 106
            ||..:.|    .|.:.|:|      :||  |.|..|       ||   .||..      |:||.|
Zfish    78 RFRGVQDVVVGEGTHFLIP------WVQ--KPIIFDCRSRPRNVP---VITGSKDLQNVNITLRI 131

  Fly   107 DGVLYLRI---IDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINK 168
               |:..:   :.....|.|.:..|..:..:....::|.:.:....::..:||.::..:.:.:.:
Zfish   132 ---LFRPVAGQLPRIFTSIGEDYDERVLPSITTEVLKSVVARFDAGELITQRELVSRQVSEDLTE 193

  Fly   169 ASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKSRILA 233
            .:..:|:......:..:.......||::|:..|:             :|||        ::|.:.
Zfish   194 RASTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQ-------------QEAE--------RARFVV 237

  Fly   234 SEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHL-DG-QNAASLTLAEQYIGAFKKLAK 296
            .:||:|:       :||.|.|..|::|  .|.||.||:.. || .....|..||..  || :|::
Zfish   238 EKAEQQK-------QAAIISAEGDSQA--ALLIANSLAEAGDGLVELRKLEAAEDI--AF-QLSR 290

  Fly   297 TNNTMILPSNPG 308
            ..|...|||..|
Zfish   291 ARNVTYLPSGQG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 30/159 (19%)
SPFH_paraslipin 80..188 CDD:259811 21/123 (17%)
Band_7_C 266..326 CDD:292817 17/45 (38%)
phbXP_005163854.1 PHB 63..224 CDD:214581 30/159 (19%)
SPFH_prohibitin 64..258 CDD:259799 44/223 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.