DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and Stoml3

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001099901.1 Gene:Stoml3 / 295041 RGDID:1311090 Length:107 Species:Rattus norvegicus


Alignment Length:71 Identity:16/71 - (22%)
Similarity:28/71 - (39%) Gaps:15/71 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PIN--MCVMFVPQQEAWVVERMGRFHRILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITSD 100
            |::  ||:..:.:.|..||.|:||..             |||.|...:.:.:.......:..|:.
  Rat    40 PVSIWMCLKIIKEYERAVVFRLGRIQ-------------ADKAKGPGTAETMGTTTTTTTTTTTT 91

  Fly   101 NVTLSI 106
            ..|.:|
  Rat    92 TTTTTI 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 15/66 (23%)
SPFH_paraslipin 80..188 CDD:259811 3/27 (11%)
Band_7_C 266..326 CDD:292817
Stoml3NP_001099901.1 SPFH_like 44..>73 CDD:302763 12/41 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.