Sequence 1: | NP_001261161.1 | Gene: | Stoml2 / 37807 | FlyBaseID: | FBgn0034936 | Length: | 366 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_694796.1 | Gene: | Stoml3 / 229277 | MGIID: | 2388072 | Length: | 287 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 68/203 - (33%) |
---|---|---|---|
Similarity: | 113/203 - (55%) | Gaps: | 9/203 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 PIN--MCVMFVPQQEAWVVERMGRFH--RILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAIT 98
Fly 99 SDNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIV 163
Fly 164 DSINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRK 228
Fly 229 SRILASEA 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Stoml2 | NP_001261161.1 | PHB | 41..199 | CDD:214581 | 55/159 (35%) |
SPFH_paraslipin | 80..188 | CDD:259811 | 40/107 (37%) | ||
Band_7_C | 266..326 | CDD:292817 | |||
Stoml3 | NP_694796.1 | PHB | 45..200 | CDD:214581 | 54/155 (35%) |
SPFH_like | 69..267 | CDD:302763 | 58/174 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0330 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |