DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and Stoml3

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_694796.1 Gene:Stoml3 / 229277 MGIID:2388072 Length:287 Species:Mus musculus


Alignment Length:203 Identity:68/203 - (33%)
Similarity:113/203 - (55%) Gaps:9/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PIN--MCVMFVPQQEAWVVERMGRFH--RILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAIT 98
            ||:  ||:..:.:.|..||.|:||..  :...|||.:::|..|....| .|:.:..::|.|..:|
Mouse    40 PISVWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPCIDVFVKV-DLRTVTCNIPPQEILT 103

  Fly    99 SDNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIV 163
            .|:||..:|||:|.||.....|...|.|...|...|||||:|:.||..::.::...||.:..||.
Mouse   104 RDSVTTQVDGVVYYRIYSAVSAVANVNDVHQATFLLAQTTLRNVLGTQTLSQILSGREEIAHSIQ 168

  Fly   164 DSINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRK 228
            ..::.|:|.|||...|.||:|:|:|.::..:|..:.||.|..||.:|.:||    |:|.::..:.
Mouse   169 TLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEATREARAKVLAAEG----EMNASKSLKS 229

  Fly   229 SRILASEA 236
            :.::.:|:
Mouse   230 ASMVLAES 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 55/159 (35%)
SPFH_paraslipin 80..188 CDD:259811 40/107 (37%)
Band_7_C 266..326 CDD:292817
Stoml3NP_694796.1 PHB 45..200 CDD:214581 54/155 (35%)
SPFH_like 69..267 CDD:302763 58/174 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.