DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and STOM

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_004090.4 Gene:STOM / 2040 HGNCID:3383 Length:288 Species:Homo sapiens


Alignment Length:206 Identity:65/206 - (31%)
Similarity:121/206 - (58%) Gaps:15/206 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PIN--MCVMFVPQQEAWVVERMGRFHRILD-----PGLNILVPVADKIKYVQSLKEIAIDVPKQS 95
            ||:  ||:..:.:.|..::.|:|   |||.     |||..::|..|....| .::.|:.|:|.|.
Human    47 PISIWMCIKIIKEYERAIIFRLG---RILQGGAKGPGLFFILPCTDSFIKV-DMRTISFDIPPQE 107

  Fly    96 AITSDNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNV 160
            .:|.|:||:|:|||:|.|:.:...|...:.:.:.|...|||||:|:.||..::.::..:||.:..
Human   108 ILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAH 172

  Fly   161 SIVDSINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEG 225
            ::..:::.|::||||...|.||:|::||.::..||..:.||.|..||.::.:||    |:|.:..
Human   173 NMQSTLDDATDAWGIKVERVEIKDVKLPVQLQRAMAAEAEASREARAKVIAAEG----EMNASRA 233

  Fly   226 KRKSRILASEA 236
            .:::.::.:|:
Human   234 LKEASMVITES 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 53/162 (33%)
SPFH_paraslipin 80..188 CDD:259811 36/107 (34%)
Band_7_C 266..326 CDD:292817
STOMNP_004090.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
SPFH_stomatin 73..274 CDD:259801 55/177 (31%)
Required for homooligomerization 265..273
Required for lipid raft association 267..269
Interaction with LANCL1. /evidence=ECO:0000269|PubMed:9512664 273..287
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.