Sequence 1: | NP_001261161.1 | Gene: | Stoml2 / 37807 | FlyBaseID: | FBgn0034936 | Length: | 366 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004090.4 | Gene: | STOM / 2040 | HGNCID: | 3383 | Length: | 288 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 65/206 - (31%) |
---|---|---|---|
Similarity: | 121/206 - (58%) | Gaps: | 15/206 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 PIN--MCVMFVPQQEAWVVERMGRFHRILD-----PGLNILVPVADKIKYVQSLKEIAIDVPKQS 95
Fly 96 AITSDNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNV 160
Fly 161 SIVDSINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEG 225
Fly 226 KRKSRILASEA 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Stoml2 | NP_001261161.1 | PHB | 41..199 | CDD:214581 | 53/162 (33%) |
SPFH_paraslipin | 80..188 | CDD:259811 | 36/107 (34%) | ||
Band_7_C | 266..326 | CDD:292817 | |||
STOM | NP_004090.4 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
SPFH_stomatin | 73..274 | CDD:259801 | 55/177 (31%) | ||
Required for homooligomerization | 265..273 | ||||
Required for lipid raft association | 267..269 | ||||
Interaction with LANCL1. /evidence=ECO:0000269|PubMed:9512664 | 273..287 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0330 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |