DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and sto-5

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001379952.1 Gene:sto-5 / 181730 WormBaseID:WBGene00006067 Length:381 Species:Caenorhabditis elegans


Alignment Length:267 Identity:76/267 - (28%)
Similarity:138/267 - (51%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CVMFVPQQEAWVVERMGRFHR--ILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITSDNVTL 104
            ||..|.:.:..|:.|:||..:  ...|||..::|..|.:|.| .|:.::.|||.|..::.|:||:
 Worm   147 CVKVVKEYQRAVIFRLGRLIKGGTKGPGLFFVLPCIDTMKIV-DLRVLSFDVPPQEILSRDSVTV 210

  Fly   105 SIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSI-NK 168
            |::.|:|.|:.:|..:...|.|.:|:...|||||:|:.||..::.::..||::: .||.:.: ::
 Worm   211 SVEAVIYFRVSNPVISVTNVNDAQFSTRLLAQTTLRNVLGTKTLSEMLSERDAI-ASISEKVLDE 274

  Fly   169 ASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKSRILA 233
            .::.||:...|.||:|||||.::..:|..:.||.||.||||:.::|.::|               
 Worm   275 GTDPWGVKVERVEIKDIRLPHQLMRSMAAEAEAVRRARAAIIAAQGEKDA--------------- 324

  Fly   234 SEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFKKL-AKT 297
                                      :.||...|.:::    ||  .:|:..:|:....|: |:.
 Worm   325 --------------------------SESLQTAADTIA----QN--KMTIQLRYLQTLTKISAQR 357

  Fly   298 NNTMILP 304
            |||:::|
 Worm   358 NNTIVMP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 53/159 (33%)
SPFH_paraslipin 80..188 CDD:259811 37/108 (34%)
Band_7_C 266..326 CDD:292817 11/40 (28%)
sto-5NP_001379952.1 SPFH_like 167..368 CDD:418525 69/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.